Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08461
Secondary Accession Numbers
  • 14173
Name Importin subunit alpha-7
Synonyms
  1. Karyopherin subunit alpha-6
Gene Name KPNA6
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran- dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular part
cytoplasm
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
nuclear pore
organelle part
intracellular organelle part
nuclear part
Function
binding
protein transporter activity
transporter activity
substrate-specific transporter activity
Process
establishment of localization
transport
protein transport
protein import into nucleus
intracellular protein transport
protein targeting
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 1p35.1
SNPs KPNA6
Gene Sequence
>1611 bp
ATGGAGACCATGGCGAGCCCAGGGAAAGACAATTATCGAATGAAGAGCTATAAGAACAAT
GCTCTAAACCCTGAAGAAATGAGACGAAGAAGAGAGGAAGAGGGCATTCAGCTCCGGAAG
CAGAAGCGAGAGCAACAACTTTTTAAACGGAGAAATGTGGAGCTGATTAATGAAGAAGCT
GCCATGTTCGATAGTCTTCTCATGGACTCTTATGTGAGCTCTACCACTGGGGAGAGTGTG
ATCACAAGAGAGATGGTGGAGATGCTCTTTTCTGATGATTCTGACCTGCAGTTAGCAACC
ACACAGAAATTCCGGAAACTGCTCTCCAAAGAGCCTAGTCCTCCAATAGATGAAGTTATC
AACACTCCAAGAGTGGTGGATCGGTTCGTGGAGTTTCTGAAGAGGAATGAGAATTGTACA
TTACAGTTTGAAGCTGCCTGGGCTCTAACGAATATTGCCTCTGGAACCTCTCAGCAGACC
AAAATTGTCATTGAAGCAGGGGCTGTCCCCATTTTTATAGAGCTGCTTAATTCAGACTTT
GAGGATGTTCAGGAACAGGCAGTCTGGGCACTGGGAAACATAGCTGGAGATAGCTCTGTT
TGCCGAGATTACGTCTTGAACTGTTCCATCCTTAATCCTTTGTTAACACTCCTTACCAAG
TCCACACGACTGACGATGACACGGAATGCAGTCTGGGCCCTGTCAAATCTCTGCCGAGGG
AAAAACCCACCCCCAGAGTTTGCAAAGGTCTCTCCTTGTTTGCCTGTACTGTCTCGCCTA
CTCTTCAGCAGCGACTCGGACTTGCTGGCAGATGCTTGCTGGGCCCTTTCTTATCTGTCT
GATGGCCCCAATGAGAAGATCCAGGCAGTCATAGACTCCGGAGTCTGCCGGAGATTGGTA
GAGCTGCTGATGCACAATGATTACAAAGTGGCTTCTCCTGCCCTGAGAGCCGTGGGTAAC
ATCGTCACTGGGGATGACATCCAGACCCAGGTCATTCTTAACTGTTCAGCCCTACCTTGC
CTTCTCCACTTGTTGAGCAGTCCCAAGGAGTCAATCCGGAAGGAAGCTTGCTGGACTATT
TCAAATATTACTGCTGGCAACAGGGCTCAAATACAGGCTGTTATAGATGCAAATATCTTC
CCTGTGTTGATCGAAATCCTTCAGAAAGCAGAGTTTCGTACAAGGAAAGAGGCAGCCTGG
GCCATCACCAATGCCACATCAGGAGGAACCCCTGAGCAGATCAGGTACCTGGTCTCACTG
GGCTGCATCAAACCCCTATGTGACTTGCTGACTGTAATGGATTCGAAGATTGTGCAAGTG
GCCCTCAATGGACTGGAGAACATCCTGCGGCTTGGAGAGCAAGAGGGCAAGCGCAGTGGC
TCAGGGGTCAATCCTTATTGTGGCCTCATAGAGGAAGCCTATGGCTTGGATAAAATTGAG
TTTCTCCAGAGCCACGAGAACCAGGAGATCTACCAGAAGGCCTTCGACCTCATTGAGCAC
TACTTTGGTGTAGAAGACGATGATAGCAGCCTGGCTCCCCAAGTCGATGAAACGCAACAG
CAGTTCATCTTCCAGCAGCCTGAGGCCCCCATGGAGGGCTTCCAGCTATAA
Protein Properties
Number of Residues 536
Molecular Weight 60028.9
Theoretical pI 4.62
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Importin subunit alpha-7
METMASPGKDNYRMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEA
AMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVI
NTPRVVDRFVEFLKRNENCTLQFEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDF
EDVQEQAVWALGNIAGDSSVCRDYVLNCSILNPLLTLLTKSTRLTMTRNAVWALSNLCRG
KNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLV
ELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTI
SNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSL
GCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNPYCGLIEEAYGLDKIE
FLQSHENQEIYQKAFDLIEHYFGVEDDDSSLAPQVDETQQQFIFQQPEAPMEGFQL
GenBank ID Protein 3091280
UniProtKB/Swiss-Prot ID O60684
UniProtKB/Swiss-Prot Entry Name IMA7_HUMAN
PDB IDs Not Available
GenBank Gene ID AF060543
GeneCard ID KPNA6
GenAtlas ID KPNA6
HGNC ID HGNC:6399
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Kohler M, Speck C, Christiansen M, Bischoff FR, Prehn S, Haller H, Gorlich D, Hartmann E: Evidence for distinct substrate specificities of importin alpha family members in nuclear protein import. Mol Cell Biol. 1999 Nov;19(11):7782-91. [PubMed:10523667 ]