You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08462
Secondary Accession Numbers
  • 14174
Name Importin subunit beta-1
Synonyms
  1. Importin-90
  2. Karyopherin subunit beta-1
  3. Nuclear factor p97
  4. PTAC97
  5. Pore targeting complex 97 kDa subunit
Gene Name KPNB1
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Functions in nuclear protein import, either in association with an adapter protein, like an importin-alpha subunit, which binds to nuclear localization signals (NLS) in cargo substrates, or by acting as autonomous nuclear transport receptor. Acting autonomously, serves itself as NLS receptor. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re- exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates autonomously the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A. In association with IPO7 mediates the nuclear import of H1 histone. In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones. In case of HIV-1 infection, binds and mediates the nuclear import of HIV-1 Rev. Imports PRKCI into the nucleus
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein transporter activity
transporter activity
substrate-specific transporter activity
Process
establishment of localization
transport
protein transport
intracellular protein transport
Cellular Location
  1. Cytoplasm
  2. Nucleus envelope
Gene Properties
Chromosome Location Chromosome:1
Locus 17q21.32
SNPs KPNB1
Gene Sequence
>2631 bp
ATGGAGCTGATCACCATTCTCGAGAAGACCGTGTCTCCCGATCGGCTGGAGCTGGAAGCG
GCGCAGAAGTTCCTGGAGCGTGCGGCCGTGGAGAACCTGCCCACTTTCCTTGTGGAACTG
TCCAGAGTGCTGGCAAATCCAGGAAACAGTCAGGTTGCCAGAGTTGCAGCTGGTCTACAA
ATCAAGAACTCTTTGACATCTAAAGATCCAGATATCAAGGCACAATATCAGCAGAGGTGG
CTTGCTATTGATGCTAATGCTCGACGAGAAGTCAAGAACTATGTTTTGCAGACATTGGGT
ACAGAAACTTACCGGCCTAGTTCTGCCTCACAGTGTGTGGCTGGTATTGCTTGTGCAGAG
ATCCCAGTAAACCAGTGGCCAGAACTCATTCCTCAGCTGGTGGCCAATGTCACAAACCCC
AACAGCACAGAGCACATGAAGGAGTCGACATTGGAAGCCATCGGTTATATTTGCCAAGAT
ATAGACCCAGAGCAGCTACAAGATAAATCCAATGAGATTCTGACTGCCATAATCCAGGGG
ATGAGGAAAGAAGAGCCTAGTAATAATGTGAAGCTAGCTGCTACGAATGCACTCCTGAAC
TCATTGGAGTTCACCAAAGCAAACTTTGATAAAGAGTCTGAAAGGCACTTTATTATGCAG
GTGGTCTGTGAAGCCACACAGTGTCCAGATACGAGGGTACGAGTGGCTGCTTTACAGAAT
CTGGTGAAGATAATGTCCTTATATTATCAGTACATGGAGACATATATGGGTCCTGCTCTT
TTTGCAATCACAATCGAAGCAATGAAAAGTGACATTGATGAGGTGGCTTTACAAGGGATA
GAATTCTGGTCCAATGTCTGTGATGAGGAAATGGATTTGGCCATTGAAGCTTCAGAGGCA
GCAGAACAAGGACGGCCCCCTGAGCACACCAGCAAGTTTTATGCGAAGGGAGCACTACAG
TATCTGGTTCCAATCCTCACACAGACACTAACTAAACAGGACGAAAATGATGATGACGAT
GACTGGAACCCCTGCAAAGCAGCAGGGGTGTGCCTCATGCTTCTGGCCACCTGCTGTGAA
GATGACATTGTCCCACATGTCCTCCCCTTCATTAAAGAACACATCAAGAACCCAGATTGG
CGGTACCGGGATGCAGCAGTGATGGCTTTTGGTTGTATCTTGGAAGGACCAGAGCCCAGT
CAGCTCAAACCACTAGTTATACAGGCTATGCCCACCCTAATAGAATTAATGAAAGACCCC
AGTGTAGTTGTTCGAGATACAGCTGCATGGACTGTAGGCAGAATTTGTGAGCTGCTTCCT
GAAGCTGCCATCAATGATGTCTACTTGGCTCCCCTGCTACAGTGTCTGATTGAGGGTCTC
AGTGCTGAACCCAGAGTGGCTTCAAATGTGTGCTGGGCTTTCTCCAGTCTGGCTGAAGCT
GCTTATGAAGCTGCAGACGTTGCTGATGATCAGGAAGAACCAGCTACTTACTGCTTATCT
TCTTCATTTGAACTCATAGTTCAGAAGCTCCTAGAGACTACAGACAGACCTGATGGACAC
CAGAACAACCTGAGGAGTTCTGCATATGAATCTCTGATGGAAATTGTGAAAAACAGTGCC
AAGGATTGTTATCCTGCTGTCCAGAAAACGACTTTGGTCATCATGGAACGACTGCAACAG
GTTCTTCAGATGGAGTCACATATCCAGAGCACATCCGATAGAATCCAGTTCAATGACCTT
CAGTCTTTACTCTGTGCAACTCTTCAGAATGTTCTTCGGAAAGTGCAACATCAAGATGCT
TTGCAGATCTCTGATGTGGTTATGGCCTCCCTGTTAAGGATGTTCCAAAGCACAGCTGGG
TCTGGGGGAGTACAAGAGGATGCCCTGATGGCAGTTAGCACACTGGTGGAAGTGTTGGGT
GGTGAATTCCTCAAGTACATGGAGGCCTTTAAACCCTTCCTGGGCATTGGATTAAAAAAT
TATGCTGAATACCAGGTTTGTTTGGCAGCTGTGGGCTTAGTGGGAGACTTGTGCCGTGCC
CTGCAATCCAACATCATACCTTTCTGTGACGAGGTGATGCAGCTGCTTCTGGAAAATTTG
GGGAATGAGAACGTCCACAGGTCTGTGAAGCCGCAGATTCTGTCAGTGTTTGGTGATATT
GCCCTTGCTATTGGAGGAGAGTTTAAAAAATACTTAGAGGTTGTATTGAATACTCTTCAG
CAGGCCTCCCAAGCCCAGGTGGACAAGTCAGACTATGACATGGTGGATTATCTGAATGAG
CTAAGGGAAAGCTGCTTGGAAGCCTATACTGGAATCGTCCAGGGATTAAAGGGGGATCAG
GAGAACGTACACCCGGATGTGATGCTGGTACAACCCAGAGTAGAATTTATTCTGTCTTTC
ATTGACCACATTGCTGGAGATGAGGATCACACAGATGGAGTAGTAGCTTGTGCTGCTGGA
CTAATAGGGGACTTATGTACAGCATTTGGGAAGGATGTACTGAAATTAGTAGAAGCTAGG
CCAATGATCCATGAATTGTTAACTGAAGGGCGGAGATCGAAGACTAACAAAGCAAAAACC
CTTGCTACATGGGCAACAAAAGAACTGAGGAAACTGAAGAACCAAGCTTGA
Protein Properties
Number of Residues 876
Molecular Weight 97169.2
Theoretical pI 4.41
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Importin subunit beta-1
MELITILEKTVSPDRLELEAAQKFLERAAVENLPTFLVELSRVLANPGNSQVARVAAGLQ
IKNSLTSKDPDIKAQYQQRWLAIDANARREVKNYVLQTLGTETYRPSSASQCVAGIACAE
IPVNQWPELIPQLVANVTNPNSTEHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQG
MRKEEPSNNVKLAATNALLNSLEFTKANFDKESERHFIMQVVCEATQCPDTRVRVAALQN
LVKIMSLYYQYMETYMGPALFAITIEAMKSDIDEVALQGIEFWSNVCDEEMDLAIEASEA
AEQGRPPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDDDWNPCKAAGVCLMLLATCCE
DDIVPHVLPFIKEHIKNPDWRYRDAAVMAFGCILEGPEPSQLKPLVIQAMPTLIELMKDP
SVVVRDTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEA
AYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSA
KDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDA
LQISDVVMASLLRMFQSTAGSGGVQEDALMAVSTLVEVLGGEFLKYMEAFKPFLGIGLKN
YAEYQVCLAAVGLVGDLCRALQSNIIPFCDEVMQLLLENLGNENVHRSVKPQILSVFGDI
ALAIGGEFKKYLEVVLNTLQQASQAQVDKSDYDMVDYLNELRESCLEAYTGIVQGLKGDQ
ENVHPDVMLVQPRVEFILSFIDHIAGDEDHTDGVVACAAGLIGDLCTAFGKDVLKLVEAR
PMIHELLTEGRRSKTNKAKTLATWATKELRKLKNQA
GenBank ID Protein 13097744
UniProtKB/Swiss-Prot ID Q14974
UniProtKB/Swiss-Prot Entry Name IMB1_HUMAN
PDB IDs
GenBank Gene ID BC003572
GeneCard ID KPNB1
GenAtlas ID KPNB1
HGNC ID HGNC:6400
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Thevenet L, Mejean C, Moniot B, Bonneaud N, Galeotti N, Aldrian-Herrada G, Poulat F, Berta P, Benkirane M, Boizet-Bonhoure B: Regulation of human SRY subcellular distribution by its acetylation/deacetylation. EMBO J. 2004 Aug 18;23(16):3336-45. Epub 2004 Aug 5. [PubMed:15297880 ]
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  7. Denis NJ, Vasilescu J, Lambert JP, Smith JC, Figeys D: Tryptic digestion of ubiquitin standards reveals an improved strategy for identifying ubiquitinated proteins by mass spectrometry. Proteomics. 2007 Mar;7(6):868-74. [PubMed:17370265 ]
  8. White WO, Seibenhener ML, Wooten MW: Phosphorylation of tyrosine 256 facilitates nuclear import of atypical protein kinase C. J Cell Biochem. 2002;85(1):42-53. [PubMed:11891849 ]
  9. Moroianu J, Blobel G, Radu A: Nuclear protein import: Ran-GTP dissociates the karyopherin alphabeta heterodimer by displacing alpha from an overlapping binding site on beta. Proc Natl Acad Sci U S A. 1996 Jul 9;93(14):7059-62. [PubMed:8692944 ]
  10. Paraskeva E, Izaurralde E, Bischoff FR, Huber J, Kutay U, Hartmann E, Luhrmann R, Gorlich D: CRM1-mediated recycling of snurportin 1 to the cytoplasm. J Cell Biol. 1999 Apr 19;145(2):255-64. [PubMed:10209022 ]
  11. Cingolani G, Bednenko J, Gillespie MT, Gerace L: Molecular basis for the recognition of a nonclassical nuclear localization signal by importin beta. Mol Cell. 2002 Dec;10(6):1345-53. [PubMed:12504010 ]
  12. Weis K, Ryder U, Lamond AI: The conserved amino-terminal domain of hSRP1 alpha is essential for nuclear protein import. EMBO J. 1996 Apr 15;15(8):1818-25. [PubMed:8617227 ]
  13. Chi NC, Adam EJ, Adam SA: Sequence and characterization of cytoplasmic nuclear protein import factor p97. J Cell Biol. 1995 Jul;130(2):265-74. [PubMed:7615630 ]
  14. Gorlich D, Kostka S, Kraft R, Dingwall C, Laskey RA, Hartmann E, Prehn S: Two different subunits of importin cooperate to recognize nuclear localization signals and bind them to the nuclear envelope. Curr Biol. 1995 Apr 1;5(4):383-92. [PubMed:7627554 ]
  15. Henderson BR, Percipalle P: Interactions between HIV Rev and nuclear import and export factors: the Rev nuclear localisation signal mediates specific binding to human importin-beta. J Mol Biol. 1997 Dec 19;274(5):693-707. [PubMed:9405152 ]
  16. Huber J, Cronshagen U, Kadokura M, Marshallsay C, Wada T, Sekine M, Luhrmann R: Snurportin1, an m3G-cap-specific nuclear import receptor with a novel domain structure. EMBO J. 1998 Jul 15;17(14):4114-26. [PubMed:9670026 ]
  17. Jakel S, Gorlich D: Importin beta, transportin, RanBP5 and RanBP7 mediate nuclear import of ribosomal proteins in mammalian cells. EMBO J. 1998 Aug 3;17(15):4491-502. [PubMed:9687515 ]
  18. Jakel S, Albig W, Kutay U, Bischoff FR, Schwamborn K, Doenecke D, Gorlich D: The importin beta/importin 7 heterodimer is a functional nuclear import receptor for histone H1. EMBO J. 1999 May 4;18(9):2411-23. [PubMed:10228156 ]
  19. Truant R, Cullen BR: The arginine-rich domains present in human immunodeficiency virus type 1 Tat and Rev function as direct importin beta-dependent nuclear localization signals. Mol Cell Biol. 1999 Feb;19(2):1210-7. [PubMed:9891055 ]
  20. Palmeri D, Malim MH: Importin beta can mediate the nuclear import of an arginine-rich nuclear localization signal in the absence of importin alpha. Mol Cell Biol. 1999 Feb;19(2):1218-25. [PubMed:9891056 ]
  21. Narayanan U, Ospina JK, Frey MR, Hebert MD, Matera AG: SMN, the spinal muscular atrophy protein, forms a pre-import snRNP complex with snurportin1 and importin beta. Hum Mol Genet. 2002 Jul 15;11(15):1785-95. [PubMed:12095920 ]
  22. Harley VR, Layfield S, Mitchell CL, Forwood JK, John AP, Briggs LJ, McDowall SG, Jans DA: Defective importin beta recognition and nuclear import of the sex-determining factor SRY are associated with XY sex-reversing mutations. Proc Natl Acad Sci U S A. 2003 Jun 10;100(12):7045-50. Epub 2003 May 22. [PubMed:12764225 ]
  23. Ghildyal R, Ho A, Wagstaff KM, Dias MM, Barton CL, Jans P, Bardin P, Jans DA: Nuclear import of the respiratory syncytial virus matrix protein is mediated by importin beta1 independent of importin alpha. Biochemistry. 2005 Sep 27;44(38):12887-95. [PubMed:16171404 ]
  24. Reimers K, Buchholz K, Werchau H: Respiratory syncytial virus M2-1 protein induces the activation of nuclear factor kappa B. Virology. 2005 Jan 20;331(2):260-8. [PubMed:15629770 ]
  25. Arnold M, Nath A, Hauber J, Kehlenbach RH: Multiple importins function as nuclear transport receptors for the Rev protein of human immunodeficiency virus type 1. J Biol Chem. 2006 Jul 28;281(30):20883-90. Epub 2006 May 16. [PubMed:16704975 ]
  26. Vetter IR, Arndt A, Kutay U, Gorlich D, Wittinghofer A: Structural view of the Ran-Importin beta interaction at 2.3 A resolution. Cell. 1999 May 28;97(5):635-46. [PubMed:10367892 ]
  27. Bayliss R, Littlewood T, Stewart M: Structural basis for the interaction between FxFG nucleoporin repeats and importin-beta in nuclear trafficking. Cell. 2000 Jul 7;102(1):99-108. [PubMed:10929717 ]