Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08468
Secondary Accession Numbers
  • 14180
Name Importin-8
Synonyms
  1. Imp8
  2. Ran-binding protein 8
  3. RanBP8
Gene Name IPO8
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Seems to function in nuclear protein import, either by acting as autonomous nuclear transport receptor or as an adapter- like protein in association with the importin-beta subunit KPNB1. Acting autonomously, is thought to serve itself as receptor for nuclear localization signals (NLS) and to promote translocation of import substrates through the nuclear pore complex (NPC) by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. In vitro mediates the nuclear import of SRP19
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein transporter activity
transporter activity
substrate-specific transporter activity
Process
establishment of localization
transport
protein transport
intracellular protein transport
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 12p11.21
SNPs IPO8
Gene Sequence
>3114 bp
ATGGACCTCAACCGGATCATCCAGGCGCTGAAGGGCACCATCGACCCGAAGTTGCGGATT
GCAGCCGAGAACGAGCTCAACCAGTCCTACAAGATTATCAATTTTGCCCCCAGTTTACTT
CGGATTATAGTCTCTGACCATGTGGAATTCCCAGTACGACAGGCAGCTGCCATTTACCTG
AAGAACATGGTGACACAATACTGGCCAGATCGAGAACCTCCACCAGGAGAAGCAATATTT
CCATTCAACATTCACGAAAACGATCGCCAGCAAATACGTGATAACATTGTGGAAGGAATA
ATTCGGTCTCCAGATTTAGTGAGAGTCCAATTAACAATGTGTCTCCGTGCCATCATAAAA
CATGATTTTCCTGGTCACTGGCCAGGAGTGGTCGACAAGATAGACTATTACTTGCAATCA
CAGAGCAGTGCAAGCTGGCTTGGCAGTTTATTATGCCTGTATCAACTGGTGAAGACATAT
GAATATAAGAAAGCAGAAGAGAGAGAACCTCTTATAATAGCAATGCAGATATTCCTGCCT
CGTATTCAGCAACAAATTGTTCAGCTCCTTCCTGATTCCTCCTATTATTCTGTATTACTG
CAGAAACAAATTCTGAAAATCTTTTATGCACTTGTTCAGTATGCATTGCCTCTTCAGCTA
GTGAATAACCAAACCATGACAACATGGATGGAGATCTTCCGAACTATTATCGACAGGACC
GTTCCTCCTGAGACTCTGCACATTGATGAGGATGATAGACCAGAACTGGTATGGTGGAAG
TGTAAGAAGTGGGCACTGCATATTGTAGCTCGGCTCTTTGAACGATATGGAAGCCCAGGA
AATGTCACAAAAGAATACTTTGAATTTTCTGAATTCTTTTTGAAAACCTATGCAGTGGGC
ATTCAGCAGGTGCTACTAAAAATTTTAGATCAATATAGACAGAAAGAATATGTAGCTCCC
CGTGTTCTTCAGCAAGCATTCAACTATCTCAACCAAGGGGTGGTTCATTCTATAACCTGG
AAGCAGATGAAGCCACACATACAGAATATCTCTGAAGATGTGATTTTTTCTGTGATGTGT
TATAAAGATGAGGATGAAGAGCTGTGGCAAGAAGATCCATATGAGTATATAAGGATGAAA
TTTGATATTTTTGAAGATTATGCTTCTCCCACCACAGCAGCCCAGACTCTCTTATATACT
GCTGCAAAGAAAAGAAAAGAGGTGTTGCCAAAAATGATGGCATTCTGTTATCAAATCCTG
ACAGACCCGAACTTTGACCCTAGGAAGAAAGATGGAGCCCTGCATGTGATTGGTTCCCTA
GCTGAGATTTTACTGAAGAAGAGTTTATTCAAGGACCAAATGGAGCTGTTTCTACAAAAT
CATGTATTTCCATTATTATTGTCTAACCTGGGATATCTTCGAGCTAGATCTTGCTGGGTA
CTTCATGCATTTAGTTCTTTGAAGTTCCATAATGAGCTCAATCTAAGAAATGCCGTTGAA
TTAGCGAAGAAGAGCCTGATTGAAGATAAAGAGATGCCTGTCAAAGTTGAAGCTGCCCTT
GCTCTTCAGTCTTTAATTTCTAACCAGATACAAGCTAAGGAATATATGAAGCCACATGTG
AGGCCTATTATGCAGGAACTGTTGCACATTGTTAGAGAGACAGAAAATGATGATGTTACT
AATGTCATCCAGAAGATGATATGTGAATACAGTCAAGAGGTAGCCTCAATTGCTGTTGAT
ATGACCCAACACTTGGCTGAGATATTTGGCAAAGTTCTTCAAAGTGATGAATATGAAGAA
GTTGAAGACAAAACAGTAATGGCTATGGGAATTTTACATACCATTGATACTATCTTAACA
GTTGTAGAAGATCATAAAGAGATTACCCAGCAGTTAGAGAATATCTGTCTACGGATCATT
GATCTTGTTCTGCAGAAACATGTAATTGAATTCTATGAAGAAATTCTTTCCCTGGCATAC
AGTTTAACCTGCCACAGTATTTCCCCTCAAATGTGGCAGCTTCTAGGTATACTATATGAA
GTGTTTCAGCAGGATTGCTTTGAATACTTTACAGACATGATGCCTCTCCTGCATAATTAT
GTGACAATAGATACAGATACCTTACTATCAAATGCAAAACATTTAGAAATTCTTTTTACA
ATGTGTAGGAAGGTACTATGTGGAGATGCAGGAGAAGATGCAGAGTGTCATGCAGCTAAA
CTTCTGGAAGTCATCATTCTTCAGTGCAAAGGAAGGGGAATTGATCAGTGCATTCCACTC
TTCGTTCAACTTGTTTTGGAGAGATTAACTCGAGGGGTCAAAACTAGTGAGCTTCGTACT
ATGTGTCTTCAGGTTGCAATTGCTGCCTTGTACTACAACCCTGATTTGCTGCTACATACT
TTAGAACGAATTCAGTTGCCTCACAACCCTGGACCTATCACTGTACAGTTTATAAATCAA
TGGATGAATGATACAGATTGTTTTCTTGGGCATCATGACCGGAAGATGTGTATAATAGGA
CTGAGTATCCTTTTGGAATTGCAAAATCGACCTCCTGCAGTAGATGCTGTGGTGGGACAG
ATTGTTCCCTCAATTCTTTTCCTTTTCCTTGGCCTAAAGCAGGTCTGTGCTACTAGACAA
CTGGTAAACCGGGAAGATCGTTCAAAAGCAGAGAAAGCTGATATGGAAGAAAATGAGGAG
ATTTCAAGTGATGAAGAGGAGACAAATGTAACTGCTCAAGCAATGCAGTCAAATAATGGA
AGAGGTGAAGATGAGGAGGAGGAAGATGATGACTGGGATGAAGAAGTATTGGAAGAAACC
GCGCTTGAGGGGTTCAGTACTCCACTTGACCTTGACAATAGTGTGGATGAATATCAGTTT
TTTACACAAGCTCTGATAACTGTGCAGAGTCGAGATGCAGCCTGGTACCAGCTGCTGATG
GCACCACTCAGCGAGGATCAGAGGACAGCACTGCAGGAGGTGTACACACTGGCAGAGCAC
CGACGGACGGTGGCAGAGGCAAAGAAGAAGATTGAACAACAGGGAGGCTTCACCTTTGAA
AACAAAGGAGTCCTCTCCGCATTTAATTTTGGGACTGTGCCCAGCAACAACTGA
Protein Properties
Number of Residues 1037
Molecular Weight 119937.0
Theoretical pI 4.8
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Importin-8
MDLNRIIQALKGTIDPKLRIAAENELNQSYKIINFAPSLLRIIVSDHVEFPVRQAAAIYL
KNMVTQYWPDREPPPGEAIFPFNIHENDRQQIRDNIVEGIIRSPDLVRVQLTMCLRAIIK
HDFPGHWPGVVDKIDYYLQSQSSASWLGSLLCLYQLVKTYEYKKAEEREPLIIAMQIFLP
RIQQQIVQLLPDSSYYSVLLQKQILKIFYALVQYALPLQLVNNQTMTTWMEIFRTIIDRT
VPPETLHIDEDDRPELVWWKCKKWALHIVARLFERYGSPGNVTKEYFEFSEFFLKTYAVG
IQQVLLKILDQYRQKEYVAPRVLQQAFNYLNQGVVHSITWKQMKPHIQNISEDVIFSVMC
YKDEDEELWQEDPYEYIRMKFDIFEDYASPTTAAQTLLYTAAKKRKEVLPKMMAFCYQIL
TDPNFDPRKKDGALHVIGSLAEILLKKSLFKDQMELFLQNHVFPLLLSNLGYLRARSCWV
LHAFSSLKFHNELNLRNAVELAKKSLIEDKEMPVKVEAALALQSLISNQIQAKEYMKPHV
RPIMQELLHIVRETENDDVTNVIQKMICEYSQEVASIAVDMTQHLAEIFGKVLQSDEYEE
VEDKTVMAMGILHTIDTILTVVEDHKEITQQLENICLRIIDLVLQKHVIEFYEEILSLAY
SLTCHSISPQMWQLLGILYEVFQQDCFEYFTDMMPLLHNYVTIDTDTLLSNAKHLEILFT
MCRKVLCGDAGEDAECHAAKLLEVIILQCKGRGIDQCIPLFVQLVLERLTRGVKTSELRT
MCLQVAIAALYYNPDLLLHTLERIQLPHNPGPITVQFINQWMNDTDCFLGHHDRKMCIIG
LSILLELQNRPPAVDAVVGQIVPSILFLFLGLKQVCATRQLVNREDRSKAEKADMEENEE
ISSDEEETNVTAQAMQSNNGRGEDEEEEDDDWDEEVLEETALEGFSTPLDLDNSVDEYQF
FTQALITVQSRDAAWYQLLMAPLSEDQRTALQEVYTLAEHRRTVAEAKKKIEQQGGFTFE
NKGVLSAFNFGTVPSNN
GenBank ID Protein 53759103
UniProtKB/Swiss-Prot ID O15397
UniProtKB/Swiss-Prot Entry Name IPO8_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_006390.3
GeneCard ID IPO8
GenAtlas ID IPO8
HGNC ID HGNC:9853
References
General References
  1. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075 ]
  5. Gorlich D, Dabrowski M, Bischoff FR, Kutay U, Bork P, Hartmann E, Prehn S, Izaurralde E: A novel class of RanGTP binding proteins. J Cell Biol. 1997 Jul 14;138(1):65-80. [PubMed:9214382 ]
  6. Dean KA, von Ahsen O, Gorlich D, Fried HM: Signal recognition particle protein 19 is imported into the nucleus by importin 8 (RanBP8) and transportin. J Cell Sci. 2001 Oct;114(Pt 19):3479-85. [PubMed:11682607 ]