Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08472
Secondary Accession Numbers
  • 14184
Name Kalirin
Synonyms
  1. Huntingtin-associated protein-interacting protein
  2. Protein Duo
  3. Serine/threonine-protein kinase with Dbl- and pleckstrin homology domain
Gene Name KALRN
Protein Type Unknown
Biological Properties
General Function Involved in Rho guanyl-nucleotide exchange factor activity
Specific Function Promotes the exchange of GDP by GTP. Activates specific Rho GTPase family members, thereby inducing various signaling mechanisms that regulate neuronal shape, growth, and plasticity, through their effects on the actin cytoskeleton. Induces lamellipodia independent of its GEF activity
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
binding
ras guanyl-nucleotide exchange factor activity
catalytic activity
rho guanyl-nucleotide exchange factor activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
enzyme regulator activity
protein kinase activity
protein serine/threonine kinase activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
phosphorus metabolic process
phosphate metabolic process
regulation of ras protein signal transduction
metabolic process
regulation of rho protein signal transduction
biological regulation
regulation of biological process
cellular metabolic process
regulation of cellular process
protein amino acid phosphorylation
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
phosphorylation
Cellular Location
  1. Cytoplasm
  2. Cytoplasm
  3. cytoskeleton
Gene Properties
Chromosome Location Chromosome:3
Locus 3q21.2
SNPs KALRN
Gene Sequence
>8961 bp
ATGACGGACCGCTTCTGGGACCAGTGGTATCTCTGGTATCTCCGCTTGCTCCGGCTGCTG
GATCGAGGGTCTTTTCGGAATGATGGTTTGAAAGCTTCTGATGTCCTTCCTATCCTAAAG
GAAAAGGTGGCCTTCGTGTCTGGGGGTCGTGATAAGCGAGGCGGACCCATCCTGACCTTC
CCTGCTCGCAGCAATCATGACAGAATAAGACAGGAAGACCTGCGGAAACTCGTGACGTAT
TTGGCCAGCGTGCCAAGTGAGGACGTGTGCAAACGTGGCTTCACTGTCATCATCGACATG
CGGGGCTCCAAGTGGGACCTCATCAAGCCCCTCCTCAAAACGCTGCAGGAAGCCTTTCCA
GCTGAGATCCATGTGGCCCTCATCATTAAACCCGACAACTTCTGGCAGAAACAGAAGACC
AACTTTGGCAGCTCCAAATTCATCTTTGAGACGAGCATGGTATCTGTGGAGGGCCTCACA
AAGCTGGTGGACCCCTCCCAGCTGACGGAGGAGTTTGATGGCTCCCTGGACTACAACCAT
GAGGAGTGGATCGAACTGCGGCTCTCCCTGGAGGAGTTCTTCAACAGCGCCGTGCACCTG
CTCTCGCGCCTCGAGGACCTCCAGGAGATGCTAGCCCGGAAGGAGTTTCCTGTGGATGTG
GAGGGCTCTCGGCGGCTCATTGACGAACACACACAGCTCAAGAAAAAGGTGCTGAAGGCC
CCTGTGGAGGAGCTGGACCGGGAGGGGCAGCGGCTGCTGCAGTGCATCCGCTGCAGCGAC
GGCTTCTCAGGACGCAACTGCATCCCGGGCAGTGCTGACTTCCAGAGCCTGGTGCCCAAG
ATCACCAGTCTCCTGGACAAGCTGCACTCCACCCGGCAGCACCTGCACCAGATGTGGCAT
GTGCGCAAGCTCAAGCTGGACCAGTGCTTTCAGCTGCGGCTCTTCGAGCAGGATGCTGAG
AAGATGTTTGACTGGATAAGCCACAACAAGGAGTTATTCCTCCAGAGCCACACGGAGATC
GGAGTCAGCTACCAGTACGCCCTTGACCTCCAGACGCAGCACAATCACTTTGCCATGAAC
TCCATGAATGCCTATGTCAACATCAACCGCATCATGTCCGTGGCTTCCCGCCTCTCTGAG
GCCGGTCATTATGCCTCACAACAAATCAAGCAGATCTCCACCCAGCTGGACCAGGAGTGG
AAGAGCTTCGCTGCTGCCCTGGATGAACGCAGCACCATCCTCGCCATGTCTGCTGTGTTC
CACCAGAAGGCTGAGCAGTTCCTGTCGGGAGTGGATGCCTGGTGCAAGATGTGCAGTGAA
GGTGGTCTGCCATCCGAGATGCAAGACCTAGAGCTGGCAATCCACCACCACCAGACCTTG
TATGAGCAGGTGACCCAAGCCTACACAGAGGTCAGCCAGGATGGCAAAGCACTACTTGAT
GTGCTGCAGCGGCCCCTGAGCCCTGGGAACTCCGAATCCCTCACGGCCACAGCCAACTAC
TCCAAGGCAGTGCACCAGGTGCTGGACGTGGTGCATGAGGTGTTACATCACCAGCGACGG
CTGGAGAGCATCTGGCAGCACCGCAAGGTGCGGCTCCACCAGCGGCTGCAGCTCTGCGTC
TTCCAGCAGGATGTACAGCAGGTGTTGGACTGGATTGAAAACCATGGTGAGGCCTTTCTC
AGCAAACACACTGGAGTTGGGAAGTCCCTACATCGAGCCCGGGCCCTGCAGAAGAGGCAT
GATGACTTTGAAGAGGTGGCTCAGAATACGTACACCAATGCGGACAAGCTCCTAGAAGCA
GCAGAGCAGTTGGCTCAGACGGGGGAATGTGACCCCGAGGAGATCTACAAGGCAGCTCGA
CACCTGGAGGTGCGCATCCAAGACTTCGTGCGCAGGGTGGAGCAGCGGAAGCTTCTCCTG
GACATGTCTGTTTCCTTCCACACACACACCAAAGAGTTGTGGACATGGATGGAAGACCTT
CAGAAGGAGATGTTGGAGGATGTCTGTGCAGATTCTGTGGATGCAGTCCAGGAACTGATC
AAGCAGTTCCAGCAGCAGCAGACCGCCACTCTAGATGCCACACTCAATGTCATCAAGGAA
GGCGAAGACCTTATCCAGCAGCTCAGGTCAGCGCCTCCCTCCCTCGGGGAGCCCAGCGAG
GCCAGGGACTCGGCTGTGTCCAACAACAAAACACCCCACAGCAGCTCCATCAGCCACATC
GAGTCGGTCCTGCAGCAGCTTGATGATGCCCAGGTGCAGATGGAGGAGCTGTTCCACGAG
CGGAAGATCAAGCTGGACATCTTCCTGCAACTGCGCATCTTTGAGCAGTACACCATCGAG
GTGACAGCAGAGCTAGACGCCTGGAATGAAGACTTGCTTCGGCAGATGAATGACTTCAAC
ACAGAGGACCTAACCCTGGCAGAACAGCGGCTGCAGCGCCACACAGAACGGAAGCTAGCC
ATGAACAACATGACCTTTGAGGTTATCCAGCAGGGACAGGATCTGCACCAGTACATCACG
GAGGTCCAGGCATCAGGAATTGAGTTGATCTGTGAAAAAGACATTGATCTGGCAGCCCAG
GTGCAAGAGTTATTGGAATTTCTCCATGAGAAGCAGCATGAATTGGAGCTCAATGCAGAG
CAGACTCATAAGCGGCTAGAGCAGTGCCTCCAATTACGTCACCTCCAGGCTGAAGTCAAA
CAGGTTCTGGGATGGATCCGCAATGGAGAGTCAATGCTCAACGCCAGCCTGGTCAATGCC
AGCTCTTTGTCGGAAGCAGAGCAGCTGCAGCGGGAGCACGAGCAGTTCCAACTGGCCATC
GAGTCCCTCTTTCATGCCACTTCCTTGCAGAAGACGCACCAGAGTGCCCTGCAGGTACAG
CAGAAAGCCGAGGTGCTGCTCCAGGCCGGCCACTACGATGCCGATGCCATCCGGGAATGT
GCTGAGAAGGTGGCCCTCCACTGGCAGCAGCTCATGCTGAAGATGGAAGACCGGCTAAAA
TTGGTCAATGCCTCTGTGGCCTTTTACAAAACTTCTGAACAGGTGTGTAGTGTCCTGGAG
AGCTTAGAGCAAGAATACCGGAGAGATGAGGACTGGTGTGGTGGACGAGATAAGCTGGGG
CCAGCAGCAGAGATCGACCATGTCATTCCCCTCATCAGCAAACATTTGGAACAAAAGGAG
GCCTTTCTTAAGGCCTGCACCCTGGCTCGGCGGAATGCTGAGGTGTTTCTCAAGTACATC
CACAGGAACAACGTCAGCATGCCCAGTGTCGCCAGCCACACTCGGGGACCCGAGCAACAA
GTGAAAGCCATCCTGAGTGAGCTCCTGCAGAGGGAGAATCGCGTGCTGCATTTCTGGACC
TTGAAGAAGCGGCGGTTAGACCAATGCCAGCAATATGTGGTGTTCGAGCGCAGCGCTAAG
CAGGCGCTTGACTGGATCCAAGAAACAGGTGAATTTTACCTCTCAACACATACCTCCACT
GGAGAGACCACAGAGGAGACTCAGGAACTGCTGAAAGAATATGGGGAATTCAGGGTGCCT
GCCAAGCAAACAAAGGAGAAGGTGAAGCTTCTGATTCAGCTGGCCGATAGCTTTGTGGAA
AAAGGCCACATTCATGCCACGGAGATAAGGAAATGGGTGACCACGGTGGACAAGCACTAC
AGAGATTTCTCCCTGAGGATGGGAAAGTACCGATACTCACTGGAGAAAGCCCTAGGAGTC
AACACAGAGGATAATAAGGACCTGGAGCTGGATATTATCCCAGCAAGCCTTTCGGATCGG
GAGGTCAAGCTGCGGGACGCCAACCACGAAGTCAATGAAGAGAAGCGGAAGTCAGCCCGG
AAGAAAGAATTTATTATGGCTGAACTACTCCAGACAGAGAAGGCTTATGTAAGGGATTTG
CATGAGTGCTTAGAGACCTACCTGTGGGAAATGACCAGTGGTGTGGAGGAGATCCCCCCT
GGGATCCTCAATAAAGAGCATATCATCTTTGGCAACATCCAAGAGATCTACGATTTCCAT
AACAACATCTTCCTCAAAGAGCTGGAGAAGTACGAGCAACTGCCTGAGGATGTGGGACAC
TGCTTTGTTACCTGGGCAGACAAATTTCAGATGTATGTCACCTACTGTAAAAACAAGCCT
GATTCCAACCAGCTTATCCTGGAGCATGCGGGCACCTTCTTTGATGAGATACAACAGCGG
CATGGTCTGGCCAACTCCATCTCTTCCTACCTAATTAAGCCTGTCCAAAGGATCACCAAA
TATCAACTGCTCCTGAAGGAACTTTTAACTTGCTGTGAAGAAGGGAAAGGGGAGCTCAAG
GATGGCCTGGAGGTGATGCTCAGTGTCCCAAAGAAAGCCAATGATGCCATGCATGTCAGC
ATGCTGGAAGGGTTCGACGAGAACCTGGATGTGCAGGGGGAGTTGATTCTCCAGGATGCC
TTTCAAGTGTGGGACCCGAAGTCGCTGATCCGGAAGGGGCGGGAGCGGCACTTGTTCCTC
TTTGAGATCTCCTTGGTTTTTAGCAAGGAGATCAAAGATTCTTCAGGACACACGAAATAT
GTTTACAAGAACAAGCTACTGACCTCAGAGCTGGGTGTGACCGAGCACGTGGAGGGCGAT
CCCTGCAAATTCGCCTTGTGGTCTGGGCGCACCCCATCCTCAGACAATAAAACAGTGCTG
AAAGCCTCCAACATTGAAACCAAGCAGGAGTGGATCAAGAACATTCGAGAAGTGATTCAA
GAAAGGATCATTCACCTGAAAGGAGCTTTAAAGGAGCCACTTCAGCTCCCCAAAACACCA
GCCAAACAGAGGAACAATAGTAAGAGGGATGGAGTGGAGGATATTGACAGCCAGGGGGAT
GGGAGCAGCCAACCAGACACCATCTCCATTGCTTCTAGGACCTCTCAGAACACAGTGGAC
AGTGACAAGCTCTCTGGTGGATGTGAGCTGACAGTGGTCCTCCAGGACTTCAGTGCGGGC
CACAGCAGTGAGCTGACCATCCAGGTGGGGCAGACGGTAGAGCTGCTGGAGCGGCCCAGC
GAGCGGCCTGGTTGGTGTCTGGTCCGTACCACCGAACGGAGCCCGCCCTTGGAGGGTCTG
GTCCCCAGCAGCGCCCTGTGCATCTCACACTCCCGAAGCAGCGTGGAGATGGACTGCTTC
TTCCCCTTGGTGAAAGATGCATACTCTCATTCCTCAAGCGAGAATGGAGGCAAGTCCGAG
TCCGTGGCCAACCTGCAGGCCCAGCCCTCCCTGAACTCCATCCACAGTTCCCCGGGTCCC
AAGCGCTCCACCAACACTCTTAAGAAGTGGCTGACGAGTCCTGTGCGTCGGCTTAACAGC
GGGAAGGCAGATGGAAACATCAAAAAGCAGAAGAAAGTTCGCGATGGTCGGAAGAGCTTT
GACCTGGGATCTCCCAAGCCTGGGGATGAAACAACCCCTCAGGGAGACAGCGCTGATGAG
AAGAGCAAGAAAGGTTGGGGTGAAGATGAGCCGGATGAAGAGTCACACACACCCCTCCCA
CCACCTATGAAGATTTTTGACAACGACCCTACACAGGATGAAATGTCCTCCTCTTTGCTA
GCAGCCCGGCAGGCTTCCACTGAAGTACCTACTGCTGCAGACCTTGTCAATGCAATAGAA
AAGTTGGTCAAAAACAAGCTGAGTCTAGAAGGAAGCTCATACCGGGGGAGCTTGAAAGAC
CCTGCAGGCTGCCTGAATGAGGGGATGGCCCCACCCACACCTCCTAAAAACCCAGAAGAA
GAACAGAAAGCCAAGGCCCTGAGAGGCAGGATGTTTGTCCTGAATGAGCTGGTACAGACA
GAGAAAGACTATGTCAAGGATCTGGGCATTGTGGTGGAGGGCTTCATGAAGAGAATAGAA
GAAAAGGGTGTCCCTGAGGATATGCGAGGAAAGGACAAAATCGTGTTTGGAAATATTCAT
CAGATTTATGACTGGCATAAGGATTTTTTCCTGGCGGAACTGGAAAAGTGTATCCAGGAG
CAAGACAGATTGGCACAGCTCTTTATTAAGCACGAGCGGAAGCTGCACATCTACGTGTGG
TATTGTCAGAATAAGCCGCGCTCAGAGTACATCGTTGCTGAGTATGACGCCTACTTTGAG
GAGGTAAAACAGGAGATAAATCAGAGGCTGACACTGAGTGACTTCCTCATCAAGCCCATT
CAGAGAATAACAAAATACCAGTTGCTCCTCAAGGACTTCCTGAGATACAGTGAGAAGGCT
GGTTTGGAGTGTTCAGATATTGAGAAAGCAGTGGAGTTAATGTGCCTTGTTCCCAAACGC
TGCAATGACATGATGAATCTAGGACGTCTGCAGGGCTTTGAGGGCACTCTGACTGCTCAG
GGGAAGCTGCTGCAGCAGGACACATTCTATGTGATCGAGCTGGATGCAGGCATGCAGTCC
CGGACCAAAGAGAGGCGCGTGTTCCTCTTCGAGCAGATTGTCATCTTCAGTGAACTGCTC
AGGAAGGGATCCCTCACCCCTGGCTACATGTTCAAAAGGAGCATCAAGATGAATTACTTG
GTCCTGGAGGAGAATGTGGACAATGATCCCTGCAAGTTTGCACTCATGAACAGAGAGACT
TCTGAGAGGGTTGTTCTGCAAGCCGCCAACGCTGACATCCAGCAGGCCTGGGTGCAGGAC
ATCAATCAAGTCTTAGAAACACAGCGAGACTTTTTGAATGCACTGCAATCGCCCATTGAG
TATCAACGGAAAGAAAGGAGCACAGCTGTGATGAGGTCTCAACCTGCCAGGCTTCCCCAA
GCCAGCCCCAGGCCCTACTCCTCTGTTCCTGCGGGCTCAGAGAAGCCCCCAAAGGGCTCC
AGCTATAACCCACCTCTGCCTCCCCTGAAGATATCTACCTCCAATGGCAGTCCAGGGTTT
GAATACCACCAGCCTGGGGACAAGTTCGAAGCCAGCAAGCAGAACGACCTGGGAGGCTGC
AATGGGACCTCGTCCATGGCCGTGATCAAAGATTACTATGCACTGAAGGAGAATGAAATC
TGTGTGAGCCAAGGTGAGGTGGTCCAGGTCCTCGCCGTCAACCAGCAGAACATGTGTCTG
GTGTACCAGCCTGCCAGCGACCATTCCCCCGCCGCCGAGGGCTGGGTCCCAGGCAGCATC
CTGGCGCCCCTCACCAAAGCCACAGCAGCAGAAAGTAGTGACGGGAGCATCAAGAAGTCA
TGTTCATGGCATACTCTACGCATGAGAAAGCGGGCGGAAGTGGAGAACACGGGTAAAAAT
GAAGCCACAGGGCCTCGTAAACCCAAGGATATTCTGGGCAACAAAGTCTCTGTTAAAGAG
ACGAACAGTTCCGAGGAATCAGAGTGTGATGATCTTGACCCTAATACTAGCATGGAGATC
TTAAATCCAAATTTCATCCAAGAAGTGGCCCCAGAATTCCTTGTGCCCTTGGTGGATGTG
ACCTGCTTGCTTGGGGACACAGTGATACTGCAGTGCAAAGTCTGTGGGCGGCCAAAGCCC
ACCATCACTTGGAAGGGTCCAGACCAGAACATCCTTGACACTGATAACAGCTCAGCCACA
TACACGGTCTCCTCTTGTGATTCTGGAGAAATCACCCTGAAGATCTGTAATCTGATGCCC
CAAGACAGTGGGATTTATACCTGCATAGCAACAAATGACCACGGGACCACATCAACGTCT
GCAACAGTCAAAGTGCAAGGTGTTCCAGCAGCCCCTAACCGCCCCATTGCCCAGGAGAGA
AGCTGCACCTCCGTGATTCTCCGCTGGCTGCCCCCCTCCAGCACAGGAAACTGCACTATT
TCTGGTTACACTGTGGAGTACAGAGAGGAAGGTTCTCAGATCTGGCAGCAGTCAGTGGCT
TCGACCTTGGACACTTACCTCGTCATCGAAGACCTTAGTCCCGGGTGTCCTTATCAGTTC
AGAGTCAGTGCCAGTAACCCCTGGGGAATCAGCCTTCCCAGCGAGCCCTCGGAGTTTGTG
CGACTTCCAGAATATGATGCTGCTGCTGATGGTGCCACCATTTCTTGGAAGGAAAATTTT
GACTCAGCTTACACTGAGCTGAATGAAATTGGAAGAGGCCGTTTCTCTATAGTAAAGAAA
TGCATTCACAAAGCTACCCGCAAAGATGTGGCTGTGAAATTTGTTAGCAAAAAAATGAAG
AAGAAAGAACAGGCTGCCCACGAGGCTGCCCTGCTTCAGCACCTACAGCACCCCCAGTAC
ATCACTCTCCATGACACCTATGAGTCCCCCACATCCTACATCCTGATCTTGGAACTGATG
GATGATGGCCGGCTCTTAGACTACCTTATGAATCATGATGAACTGATGGAGGAAAAAGTA
GCTTTCTATATCCGAGACATCATGGAGGCTCTGCAGTACCTTCACAACTGCAGGGTTGCA
CATTTGGACATAAAGCCTGAAAACCTGCTCATTGACCTACGGATTCCAGTGCCTCGAGTG
AAGCTCATTGACTTGGAGGATGCTGTCCAGATCTCGGGTCACTTCCACATTCACCACCTG
CTGGGGAACCCTGAGTTTGCTGCCCCAGAAGTCATTCAAGGCATCCCCGTCTCCCTGGGG
ACAGACATCTGGAGCATCGGGGTTCTGACATATGTCATGCTGAGTGGGGTCTCCCCCTTC
TTGGATGAGAGCAAAGAGGAGACATGTATCAACGTATGCAGGGTGGATTTCAGCTTCCCC
CATGAATACTTCTGTGGTGTGAGCAATGCTGCCAGAGATTTCATCAATGTGATCTTACAG
GAAGATTTTCGGAGGCGGCCCACAGCAGCCACATGCTTGCAGCATCCATGGCTGCAGCCC
CATAATGGCAGCTACTCTAAGATCCCCCTGGACACCTCCCGCCTAGCATGCTTCATAGAA
CGTCGCAAGCACCAGAATGATGTGCGGCCTATTCCCAATGTCAAGAGCTACATTGTCAAC
CGGGTGAACCAAGGGACGTAG
Protein Properties
Number of Residues 2985
Molecular Weight 340171.2
Theoretical pI 5.97
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Kalirin
MTDRFWDQWYLWYLRLLRLLDRGSFRNDGLKASDVLPILKEKVAFVSGGRDKRGGPILTF
PARSNHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFP
AEIHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNH
EEWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKA
PVEELDREGQRLLQCIRCSDGFSGRNCIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWH
VRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQYALDLQTQHNHFAMN
SMNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVF
HQKAEQFLSGVDAWCKMCSEGGLPSEMQDLELAIHHHQTLYEQVTQAYTEVSQDGKALLD
VLQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCV
FQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEA
AEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDL
QKEMLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPSE
ARDSAVSNNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQLRIFEQYTIE
VTAELDAWNEDLLRQMNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIT
EVQASGIELICEKDIDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVK
QVLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIESLFHATSLQKTHQSALQVQ
QKAEVLLQAGHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLE
SLEQEYRRDEDWCGGRDKLGPAAEIDHVIPLISKHLEQKEAFLKACTLARRNAEVFLKYI
HRNNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAK
QALDWIQETGEFYLSTHTSTGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVE
KGHIHATEIRKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDLELDIIPASLSDR
EVKLRDANHEVNEEKRKSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPP
GILNKEHIIFGNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKP
DSNQLILEHAGTFFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGELK
DGLEVMLSVPKKANDAMHVSMLEGFDENLDVQGELILQDAFQVWDPKSLIRKGRERHLFL
FEISLVFSKEIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPSSDNKTVL
KASNIETKQEWIKNIREVIQERIIHLKGALKEPLQLPKTPAKQRNNSKRDGVEDIDSQGD
GSSQPDTISIASRTSQNTVDSDKLSGGCELTVVLQDFSAGHSSELTIQVGQTVELLERPS
ERPGWCLVRTTERSPPLEGLVPSSALCISHSRSSVEMDCFFPLVKDAYSHSSSENGGKSE
SVANLQAQPSLNSIHSSPGPKRSTNTLKKWLTSPVRRLNSGKADGNIKKQKKVRDGRKSF
DLGSPKPGDETTPQGDSADEKSKKGWGEDEPDEESHTPLPPPMKIFDNDPTQDEMSSLLA
ARQASTEVPTAADLVNAIEKLVKNKLSLEGSSYRGSLKDPAGCLNEGMAPPTPPKNPEEE
QKAKALRGRMFVLNELVQTEKDYVKDLGIVVEGFMKRIEEKGVPEDMRGKDKIVFGNIHQ
IYDWHKDFFLAELEKCIQEQDRLAQLFIKHERKLHIYVWYCQNKPRSEYIVAEYDAYFEE
VKQEINQRLTLSDFLIKPIQRITKYQLLLKDFLRYSEKAGLECSDIEKAVELMCLVPKRC
NDMMNLGRLQGFEGTLTAQGKLLQQDTFYVIELDAGMQSRTKERRVFLFEQIVIFSELLR
KGSLTPGYMFKRSIKMNYLVLEENVDNDPCKFALMNRETSERVVLQAANADIQQAWVQDI
NQVLETQRDFLNALQSPIEYQRKERSTAVMRSQPARLPQASPRPYSSVPAGSEKPPKGSS
YNPPLPPLKISTSNGSPGFEYHQPGDKFEASKQNDLGGCNGTSSMAVIKDYYALKENEIC
VSQGEVVQVLAVNQQNMCLVYQPASDHSPAAEGWVPGSILAPLTKATAAESSDGSIKKSC
SWHTLRMRKRAEVENTGKNEATGPRKPKDILGNKVSVKETNSSEESECDDLDPNTSMEIL
NPNFIQEVAPEFLVPLVDVTCLLGDTVILQCKVCGRPKPTITWKGPDQNILDTDNSSATY
TVSSCDSGEITLKICNLMPQDSGIYTCIATNDHGTTSTSATVKVQGVPAAPNRPIAQERS
CTSVILRWLPPSSTGNCTISGYTVEYREEGSQIWQQSVASTLDTYLVIEDLSPGCPYQFR
VSASNPWGISLPSEPSEFVRLPEYDAAADGATISWKENFDSAYTELNEIGRGRFSIVKKC
IHKATRKDVAVKFVSKKMKKKEQAAHEAALLQHLQHPQYITLHDTYESPTSYILILELMD
DGRLLDYLMNHDELMEEKVAFYIRDIMEALQYLHNCRVAHLDIKPENLLIDLRIPVPRVK
LIDLEDAVQISGHFHIHHLLGNPEFAAPEVIQGIPVSLGTDIWSIGVLTYVMLSGVSPFL
DESKEETCINVCRVDFSFPHEYFCGVSNAARDFINVILQEDFRRRPTAATCLQHPWLQPH
NGSYSKIPLDTSRLACFIERRKHQNDVRPIPNVKSYIVNRVNQGT
GenBank ID Protein 148839466
UniProtKB/Swiss-Prot ID O60229
UniProtKB/Swiss-Prot Entry Name KALRN_HUMAN
PDB IDs
GenBank Gene ID NM_001024660
GeneCard ID KALRN
GenAtlas ID KALRN
HGNC ID HGNC:4814
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  5. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  6. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  7. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  8. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997 ]
  9. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  10. Colomer V, Engelender S, Sharp AH, Duan K, Cooper JK, Lanahan A, Lyford G, Worley P, Ross CA: Huntingtin-associated protein 1 (HAP1) binds to a Trio-like polypeptide, with a rac1 guanine nucleotide exchange factor domain. Hum Mol Genet. 1997 Sep;6(9):1519-25. [PubMed:9285789 ]
  11. Kawai T, Sanjo H, Akira S: Duet is a novel serine/threonine kinase with Dbl-Homology (DH) and Pleckstrin-Homology (PH) domains. Gene. 1999 Feb 18;227(2):249-55. [PubMed:10023074 ]
  12. Wang L, Hauser ER, Shah SH, Pericak-Vance MA, Haynes C, Crosslin D, Harris M, Nelson S, Hale AB, Granger CB, Haines JL, Jones CJ, Crossman D, Seo D, Gregory SG, Kraus WE, Goldschmidt-Clermont PJ, Vance JM: Peakwide mapping on chromosome 3q13 identifies the kalirin gene as a novel candidate gene for coronary artery disease. Am J Hum Genet. 2007 Apr;80(4):650-63. Epub 2007 Feb 8. [PubMed:17357071 ]