Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08473
Secondary Accession Numbers
  • 14185
Name NF-kappa-B inhibitor-interacting Ras-like protein 1
Synonyms
  1. I-kappa-B-interacting Ras-like protein 1
  2. Kappa B-Ras protein 1
  3. KappaB-Ras1
Gene Name NKIRAS1
Protein Type Unknown
Biological Properties
General Function Involved in GTP binding
Specific Function Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signal transduction
small gtpase mediated signal transduction
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:3
Locus 3p24.2
SNPs NKIRAS1
Gene Sequence
>579 bp
ATGGGAAAGGGCTGCAAGGTTGTGGTTTGTGGATTGTTATCTGTGGGGAAAACTGCAATT
TTGGAGCAGCTCCTTTATGGAAATCATACTATTGGAATGGAAGATTGCGAAACAATGGAA
GATGTATACATGGCTTCAGTAGAAACAGACCGAGGAGTAAAAGAACAGTTACATCTTTAT
GACACCAGAGGTCTACAGGAAGGCGTGGAGCTGCCAAAGCATTATTTTTCATTTGCTGAT
GGCTTCGTTCTTGTGTACAGTGTGAATAACCTTGAATCCTTTCAAAGAGTGGAGCTTCTG
AAGAAAGAAATCGATAAGTTCAAAGACAAAAAAGAGGTAGCAATTGTGGTATTAGGAAAC
AAAATCGACCTTTCTGAGCAGAGACAAGTGGACGCTGAAGTGGCACAGCAGTGGGCAAAA
AGTGAGAAAGTAAGACTGTGGGAGGTGACTGTTACAGATCGGAAAACTCTGATTGAACCA
TTCACTTTATTAGCCAGTAAACTTTCTCAACCCCAGAGCAAATCAAGCTTTCCTTTGCCT
GGGAGGAAAAACAAAGGGAACTCTAATTCTGAGAACTAA
Protein Properties
Number of Residues 192
Molecular Weight 21642.7
Theoretical pI 6.28
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>NF-kappa-B inhibitor-interacting Ras-like protein 1
MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLY
DTRGLQEGVELPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGN
KIDLSEQRQVDAEVAQQWAKSEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLP
GRKNKGNSNSEN
GenBank ID Protein 7008402
UniProtKB/Swiss-Prot ID Q9NYS0
UniProtKB/Swiss-Prot Entry Name KBRS1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF229839
GeneCard ID NKIRAS1
GenAtlas ID NKIRAS1
HGNC ID HGNC:17899
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Fenwick C, Na SY, Voll RE, Zhong H, Im SY, Lee JW, Ghosh S: A subclass of Ras proteins that regulate the degradation of IkappaB. Science. 2000 Feb 4;287(5454):869-73. [PubMed:10657303 ]
  4. Chen Y, Wu J, Ghosh G: KappaB-Ras binds to the unique insert within the ankyrin repeat domain of IkappaBbeta and regulates cytoplasmic retention of IkappaBbeta x NF-kappaB complexes. J Biol Chem. 2003 Jun 20;278(25):23101-6. Epub 2003 Apr 2. [PubMed:12672800 ]
  5. Chen Y, Vallee S, Wu J, Vu D, Sondek J, Ghosh G: Inhibition of NF-kappaB activity by IkappaBbeta in association with kappaB-Ras. Mol Cell Biol. 2004 Apr;24(7):3048-56. [PubMed:15024091 ]