You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08485
Secondary Accession Numbers
  • 14197
Name Serine/threonine-protein kinase MRCK alpha
Synonyms
  1. CDC42-binding protein kinase alpha
  2. DMPK-like alpha
  3. MRCK alpha
  4. Myotonic dystrophy kinase-related CDC42-binding kinase alpha
  5. Myotonic dystrophy protein kinase-like alpha
Gene Name CDC42BPA
Protein Type Unknown
Biological Properties
General Function Involved in protein serine/threonine kinase activity
Specific Function May act as a downstream effector of CDC42 in cytoskeletal reorganization. Contributes to the actomyosin contractility required for cell invasion, through the regulation of MYPT1 and thus MLC2 phosphorylation
Pathways Not Available
Reactions Not Available
GO Classification
Function
small gtpase regulator activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
enzyme regulator activity
protein kinase activity
protein serine/threonine kinase activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
intracellular signaling pathway
signaling
signaling pathway
phosphorylation
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 1q42.11
SNPs CDC42BPA
Gene Sequence
>5160 bp
ATGTCTGGAGAAGTGCGTTTGAGGCAGTTGGAGCAGTTTATTTTGGACGGGCCCGCTCAG
ACCAATGGGCAGTGCTTCAGTGTGGAGACATTACTGGATATACTCATCTGCCTTTATGAT
GAATGCAATAATTCTCCATTGAGAAGAGAGAAGAACATTCTCGAATACCTAGAATGGGCT
AAACCATTTACTTCTAAAGTGAAACAAATGCGATTACATAGAGAAGACTTTGAAATATTA
AAGGTGATTGGTCGAGGAGCTTTTGGGGAGGTTGCTGTAGTAAAACTAAAAAATGCAGAT
AAAGTGTTTGCCATGAAAATATTGAATAAATGGGAAATGCTGAAAAGAGCTGAGACAGCA
TGTTTTCGTGAAGAAAGGGATGTATTAGTGAATGGAGACAATAAATGGATTACAACCTTG
CACTATGCTTTCCAGGATGACAATAACTTATACCTGGTTATGGATTATTATGTTGGTGGG
GATTTGCTTACTCTACTCAGCAAATTTGAAGATAGATTGCCTGAAGATATGGCTAGATTT
TACTTGGCTGAGATGGTGATAGCAATTGACTCAGTTCATCAGCTACATTATGTACACAGA
GACATTAAACCTGACAATATACTGATGGATATGAATGGACATATTCGGTTAGCAGATTTT
GGTTCTTGTCTGAAGCTGATGGAAGATGGAACGGTTCAGTCCTCAGTGGCTGTAGGAACT
CCAGATTATATCTCTCCTGAAATCCTTCAAGCCATGGAAGATGGAAAAGGGAGATATGGA
CCTGAATGTGACTGGTGGTCTTTGGGGGTCTGTATGTATGAAATGCTTTACGGAGAAACA
CCATTTTATGCAGAATCGCTGGTGGAGACATACGGAAAAATCATGAACCACAAAGAGAGG
TTTCAGTTTCCAGCCCAAGTGACTGATGTGTCTGAAAATGCTAAGGATCTTATTCGAAGG
CTCATTTGTAGCAGAGAACATCGACTTGGTCAAAATGGAATAGAAGACTTTAAGAAACAC
CCATTTTTCAGTGGAATTGATTGGGATAATATTCGGAACTGTGAAGCACCTTATATTCCA
GAAGTTAGTAGCCCAACAGATACATCGAATTTTGATGTAGATGATGATTGTTTAAAAAAT
TCTGAAACGATGCCCCCACCAACACATACTGCATTTTCTGGCCACCATCTGCCATTTGTT
GGTTTTACATATACTAGTAGCTGTGTACTTTCTGATCGGAGCTGTTTAAGAGTTACGGCT
GGTCCCACCTCACTGGATCTTGATGTTAATGTTCAGAGGACTCTAGACAACAACTTAGCA
ACTGAAGCTTATGAAAGAAGAATTAAGCGCCTTGAGCAAGAAAAACTTGAACTCAGTAGA
AAACTTCAAGAGTCAACACAGACTGTCCAAGCTCTGCAGTATTCAACTGTTGATGGTCCA
CTAACAGCAAGCAAAGATTTAGAAATAAAAAACTTAAAAGAAGAAATTGAAAAACTAAGA
AAACAAGTAACAGAATCAAGTCATTTGGAACAGCAACTTGAAGAAGCTAATGCTGTGAGG
CAAGAACTAGATGATGCTTTTAGACAAATCAAGGCTTATGAAAAACAAATCAAAACGTTA
CAACAAGAAAGAGAAGATCTAAATAAGGAACTAGTCCAGGCTAGTGAGCGATTAAAAAAC
CAATCCAAAGAGCTGAAAGACGCACACTGTCAGAGGAAACTGGCCATGCAGGAATTCATG
GAGATCAATGAGCGGCTAACAGAATTGCACACCCAAAAACAGAAACTTGCTCGCCATGTC
CGAGATAAGGAAGAAGAGGTGGACCTGGTGATGCAAAAAGTTGAAAGCTTAAGGCAAGAA
CTGCGCAGAACAGAAAGAGCCAAAAAAGAGCTGGAAGTTCATACAGAAGCTCTAGCTGCT
GAAGCATCTAAAGACAGGAAGCTACGTGAACAGAGTGAGCACTATTCTAAGCAACTGGAA
AATGAATTGGAGGGACTGAAGCAAAAACAAATTAGTTACTCACCAGGAGTATGCAGCATA
GAACATCAGCAAGAGATAACCAAACTAAAGACTGATTTGGAAAAGAAAAGTATCTTTTAT
GAAGAAGAATTATCTAAAAGAGAAGGAATACATGCAAATGAAATAAAAAATCTTAAGAAA
GAACTGCATGATTCAGAAGGTCAGCAACTTGCTCTCAACAAAGAAATTATGATTTTAAAA
GACAAATTGGAAAAAACCAGAAGAGAAAGTCAAAGTGAAAGGGAGGAATTTGAAAGTGAG
TTCAAACAACAATATGAACGAGAAAAAGTGTTGTTAACTGAAGAAAATAAAAAGCTGACG
AGTGAACTTGATAAGCTTACTACTTTGTATGAGAACTTAAGTATACACAACCAGCAGTTA
GAAGAAGAGGTTAAAGATCTAGCAGACAAGAAAGAATCAGTTGCACATTGGGAAGCCCAA
ATCACAGAAATAATTCAGTGGGTCAGCGATGAAAAGGATGCACGAGGGTATCTTCAGGCC
TTAGCTTCTAAAATGACTGAAGAATTGGAGGCATTAAGAAATTCCAGCTTGGGTACACGA
GCAACAGATATGCCCTGGAAAATGCGTCGTTTTGCGAAACTGGATATGTCAGCTAGACTG
GAGTTGCAGTCGGCTCTGGATGCAGAAATAAGAGCCAAACAGGCCATCCAAGAAGAGTTG
AATAAAGTTAAAGCATCTAATATCATAACAGAATGTAAACTAAAAGATTCAGAGAAGAAG
AACTTGGAACTACTCTCAGAAATCGAACAGCTGATAAAGGACACTGAAGAGCTTAGATCT
GAAAAGGGTATAGAGCACCAAGACTCACAGCATTCTTTCTTGGCATTTTTGAATACGCCT
ACCGATGCTCTGGATCAATTTGAAACTGTAGACTCCACTCCACTTTCAGTTCACACACCA
ACCTTAAGGAAAAAAGGATGTCCTGGTTCAACTGGCTTTCCACCTAAGCGCAAGACTCAC
CAGTTTTTTGTAAAATCTTTTACTACTCCTACCAAGTGTCATCAGTGTACCTCCTTGATG
GTGGGTTTAATAAGACAGGGCTGTTCATGTGAAGTGTGTGGATTCTCATGCCATATAACT
TGTGTAAACAAAGCTCCAACCACTTGTCCAGTTCCTCCTGAACAGACAAAAGGTCCCCTG
GGTATAGATCCTCAGAAAGGAATAGGAACAGCATATGAAGGTCATGTCAGGATTCCTAAG
CCAGCTGGAGTGAAGAAAGGGTGGCAGAGAGCACTGGCTATAGTGTGTGACTTCAAACTC
TTTCTGTACGATATTGCTGAAGGAAAAGCATCTCAGCCCAGTGTTGTCATTAGTCAAGTG
ATTGACATGAGGGATGAAGAATTTTCTGTGAGTTCAGTCTTGGCTTCTGATGTTATCCAT
GCAAGTCGGAAAGATATACCCTGTATATTTAGGGTCACAGCTTCCCAGCTCTCAGCATCT
AATAACAAATGTTCAATCCTGATGCTAGCAGACACTGAGAATGAGAAGAATAAGTGGGTG
GGAGTGCTGAGTGAATTGCACAAGATTTTGAAGAAAAACAAATTCAGAGACCGCTCAGTC
TATGTTCCCAAAGAGGCTTATGACAGCACTCTACCCCTCATTAAAACAACCCAGGCAGCC
GCAATCATAGATCATGAAAGAATTGCTTTGGGAAACGAAGAAGGGTTATTTGTTGTACAT
GTCACCAAAGATGAAATTATTAGAGTTGGTGACAATAAGAAGATTCATCAGATTGAACTC
ATTCCAAATGATCAGCTTGTTGCTGTGATCTCAGGACGAAATCGTCATGTACGACTTTTT
CCTATGTCAGCATTGGATGGGCGAGAGACCGATTTTTACAAGCTGTCAGAAACTAAAGGG
TGTCAAACCGTAACTTCTGGAAAGGTGCGCCATGGAGCTCTCACATGCCTGTGTGTGGCT
ATGAAAAGGCAGGTCCTCTGTTATGAACTATTTCAGAGCAAGACCCGTCACAGAAAATTT
AAAGAAATTCAAGTCCCATATAATGTCCAGTGGATGGCAATCTTCAGTGAACAACTCTGT
GTGGGATTCCAGTCAGGATTTCTAAGATACCCCTTGAATGGAGAAGGAAATCCATACAGT
ATGCTCCATTCAAATGACCATACACTATCATTTATTGCACATCAACCAATGGATGCTATC
TGCGCAGTTGAGATCTCCAGTAAAGAATATCTGCTGTGTTTTAACAGCATTGGGATATAC
ACTGACTGCCAGGGCCGAAGATCTAGACAACAGGAATTGATGTGGCCAGCAAATCCTTCC
TCTTGTTGTTACAATGCACCATATCTCTCGGTGTACAGTGAAAATGCAGTTGATATCTTT
GATGTGAACTCCATGGAATGGATTCAGACTCTTCCTCTCAAAAAGGTTCGACCCTTAAAC
AATGAAGGATCATTAAATCTTTTAGGGTTGGAGACCATTAGATTAATATATTTCAAAAAT
AAGATGGCAGAAGGGGACGAACTGGTAGTACCTGAAACATCAGATAATAGTCGGAAACAA
ATGGTTAGAAACATTAACAATAAGCGGCGTTATTCCTTCAGAGTCCCAGAAGAGGAAAGG
ATGCAGCAGAGGAGGGAAATGCTACGAGATCCAGAAATGAGAAATAAATTAATTTCTAAT
CCAACTAATTTTAATCACATAGCACACATGGGTCCTGGAGATGGAATACAGATCCTGAAA
GATCTGCCCATGAACCCTCGGCCTCAGGAAAGTCGGACAGTATTCAGTGGCTCAGTCAGT
ATTCCATCTATCACCAAATCCCGCCCTGAGCCAGGCCGCTCCATGAGTGCTAGCAGTGGC
TTGTCAGCAAGGTCATCCGCACAGAATGGCAGCGCATTAAAGAGGGAATTCTCTGGAGGA
AGCTACAGTGCCAAGCGGCAGCCCATGCCCTCCCCGTCAGAGGGCTCTTTGTCCTCTGGA
GGCATGGACCAAGGAAGTGATGCCCCAGCGAGGGACTTTGACGGAGAGGACTCTGACTCT
CCGAGGCATTCCACAGCTTCCAACAGTTCCAACCTAAGCAGCCCCCCAAGCCCAGCTTCA
CCCCGAAAAACCAAGAGCCTCTCCCTGGAGAGCACTGACCGCGGGAGCTGGGACCCGTGA
Protein Properties
Number of Residues 1732
Molecular Weight 197305.2
Theoretical pI 6.55
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase MRCK alpha
MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWA
KPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETA
CFREERDVLVNGDNKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARF
YLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGT
PDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKER
FQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIP
EVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTA
GPTSLDLDVNVQRTLDNNLATEAYERRIKRLEQEKLELSRKLQESTQTVQALQYSTVDGP
LTASKDLEIKNLKEEIEKLRKQVTESSHLEQQLEEANAVRQELDDAFRQIKAYEKQIKTL
QQEREDLNKELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHV
RDKEEEVDLVMQKVESLRQELRRTERAKKELEVHTEALAAEASKDRKLREQSEHYSKQLE
NELEGLKQKQISYSPGVCSIEHQQEITKLKTDLEKKSIFYEEELSKREGIHANEIKNLKK
ELHDSEGQQLALNKEIMILKDKLEKTRRESQSEREEFESEFKQQYEREKVLLTEENKKLT
SELDKLTTLYENLSIHNQQLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQA
LASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEEL
NKVKASNIITECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTP
TDALDQFERSPSCTPASKGRRTVDSTPLSVHTPTLRKKGCPGSTGFPPKRKTHQFFVKSF
TTPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCVNKAPTTCPVPPEQTKGPLGIDPQKG
IGTAYEGHVRIPKPAGVKKGWQRALAIVCDFKLFLYDIAEGKASQPSVVISQVIDMRDEE
FSVSSVLASDVIHASRKDIPCIFRVTASQLSASNNKCSILMLADTENEKNKWVGVLSELH
KILKKNKFRDRSVYVPKEAYDSTLPLIKTTQAAAIIDHERIALGNEEGLFVVHVTKDEII
RVGDNKKIHQIELIPNDQLVAVISGRNRHVRLFPMSALDGRETDFYKLSETKGCQTVTSG
KVRHGALTCLCVAMKRQVLCYELFQSKTRHRKFKEIQVPYNVQWMAIFSEQLCVGFQSGF
LRYPLNGEGNPYSMLHSNDHTLSFIAHQPMDAICAVEISSKEYLLCFNSIGIYTDCQGRR
SRQQELMWPANPSSCCYNAPYLSVYSENAVDIFDVNSMEWIQTLPLKKVRPLNNEGSLNL
LGLETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNINNKRRYSFRVPEEERMQQRREM
LRDPEMRNKLISNPTNFNHIAHMGPGDGIQILKDLPMNPRPQESRTVFSGSVSIPSITKS
RPEPGRSMSASSGLSARSSAQNGSALKREFSGGSYSAKRQPMPSPSEGSLSSGGMDQGSD
APARDFDGEDSDSPRHSTASNSSNLSSPPSPASPRKTKSLSLESTDRGSWDP
GenBank ID Protein 30089962
UniProtKB/Swiss-Prot ID Q5VT25
UniProtKB/Swiss-Prot Entry Name MRCKA_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_003607
GeneCard ID CDC42BPA
GenAtlas ID CDC42BPA
HGNC ID HGNC:1737
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Seki N, Ohira M, Nagase T, Ishikawa K, Miyajima N, Nakajima D, Nomura N, Ohara O: Characterization of cDNA clones in size-fractionated cDNA libraries from human brain. DNA Res. 1997 Oct 31;4(5):345-9. [PubMed:9455484 ]
  6. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  7. Wilkinson S, Paterson HF, Marshall CJ: Cdc42-MRCK and Rho-ROCK signalling cooperate in myosin phosphorylation and cell invasion. Nat Cell Biol. 2005 Mar;7(3):255-61. Epub 2005 Feb 20. [PubMed:15723050 ]
  8. Zhao Y, Loyer P, Li H, Valentine V, Kidd V, Kraft AS: Cloning and chromosomal location of a novel member of the myotonic dystrophy family of protein kinases. J Biol Chem. 1997 Apr 11;272(15):10013-20. [PubMed:9092543 ]
  9. Leung T, Chen XQ, Tan I, Manser E, Lim L: Myotonic dystrophy kinase-related Cdc42-binding kinase acts as a Cdc42 effector in promoting cytoskeletal reorganization. Mol Cell Biol. 1998 Jan;18(1):130-40. [PubMed:9418861 ]
  10. Tan I, Seow KT, Lim L, Leung T: Intermolecular and intramolecular interactions regulate catalytic activity of myotonic dystrophy kinase-related Cdc42-binding kinase alpha. Mol Cell Biol. 2001 Apr;21(8):2767-78. [PubMed:11283256 ]