You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08486
Secondary Accession Numbers
  • 14198
Name Serine/threonine-protein kinase MRCK beta
Synonyms
  1. CDC42-binding protein kinase beta
  2. DMPK-like beta
  3. MRCK beta
  4. Myotonic dystrophy kinase-related CDC42-binding kinase beta
  5. Myotonic dystrophy protein kinase-like beta
Gene Name CDC42BPB
Protein Type Unknown
Biological Properties
General Function Involved in protein serine/threonine kinase activity
Specific Function May act as a downstream effector of CDC42 in cytoskeletal reorganization. Contributes to the actomyosin contractility required for cell invasion, through the regulation of MYPT1 and thus MLC2 phosphorylation
Pathways Not Available
Reactions Not Available
GO Classification
Function
small gtpase regulator activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
enzyme regulator activity
protein kinase activity
protein serine/threonine kinase activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
intracellular signaling pathway
signaling
signaling pathway
phosphorylation
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 14q32.3
SNPs CDC42BPB
Gene Sequence
>5136 bp
ATGTCGGCCAAGGTGCGGCTCAAGAAGCTGGAGCAGCTGCTCCTGGACGGGCCCTGGCGC
AACGAGAGCGCCCTGAGCGTGGAAACGCTGCTCGACGTGCTCGTCTGCCTGTACACCGAG
TGCAGCCACTCGGCCCTGCGCCGCGACAAGTACGTGGCCGAGTTCCTCGAGTGGGCTAAA
CCATTTACACAGCTGGTGAAAGAAATGCAGCTTCATCGAGAAGACTTTGAAATAATTAAA
GTAATTGGAAGAGGTGCTTTTGGTGAGGTTGCTGTTGTCAAAATGAAGAATACTGAACGA
ATTTATGCAATGAAAATCCTCAACAAGTGGGAGATGCTGAAAAGAGCAGAGACCGCGTGC
TTCCGAGAGGAGCGCGATGTGCTGGTGAACGGCGACTGCCAGTGGATCACCGCGCTGCAC
TACGCCTTTCAGGACGAGAACCACCTGTACTTAGTCATGGATTACTATGTGGGTGGTGAT
TTACTGACCCTGCTCAGCAAATTTGAAGACAAGCTTCCGGAAGATATGGCGAGGTTCTAC
ATTGGTGAAATGGTGCTGGCCATTGACTCCATCCATCAGCTTCATTACGTGCACAGAGAC
ATTAAACCTGACAATGTCCTTTTGGACGTGAATGGTCATATCCGCCTGGCTGACTTTGGA
TCATGTTTGAAGATGAATGATGATGGCACTGTGCAGTCCTCCGTGGCCGTGGGCACACCT
GACTACATCTCGCCGGAGATCCTGCAGGCGATGGAGGACGGCATGGGCAAATACGGGCCT
GAGTGTGACTGGTGGTCTCTGGGTGTCTGCATGTATGAGATGCTCTATGGAGAAACGCCG
TTTTATGCGGAGTCACTCGTGGAGACCTATGGGAAGATCATGAACCATGAAGAGCGATTC
CAGTTCCCATCCCATGTCACGGATGTATCTGAAGAAGCGAAGGACCTCATCCAGAGACTG
ATCTGCAGTAGAGAACGCCGGCTGGGGCAGAATGGAATAGAGGATTTCAAAAAGCATGCG
TTTTTTGAAGGTCTAAATTGGGAAAATATACGAAACCTAGAAGCACCTTATATTCCTGAT
GTGAGCAGTCCCTCTGACACATCCAACTTCGACGTGGATGACGACGTGCTGAGAAACACG
GAAATATTACCTCCTGGTTCTCACACAGGCTTTTCTGGATTACATTTGCCATTCATTGGT
TTTACATTCACAACGGAAAGCTGTTTTTCTGATCGAGGCTCTCTGAAGAGCATAATGCAG
TCCAACACATTAACCAAAGATGAGGATGTGCAGCGGGACCTGGAGCACAGCCTGCAGATG
GAAGCTTACGAGAGGAGGATTCGGAGGCTGGAACAGGAGAAGCTGGAGCTGAGCAGGAAG
CTGCAAGAGTCCACCCAGACCGTGCAGTCCCTCCACGGCTCATCTCGGGCCCTCAGCAAT
TCAAACCGAGATAAAGAAATCAAAAAGCTAAATGAAGAAATCGAACGCTTGAAGAATAAA
ATAGCAGATTCAAACAGGCTCGAGCGACAGCTTGAGGACACAGTGGCGCTTCGCCAAGAG
CGTGAGGACTCCACGCAGCGGCTGCGGGGGCTGGAGAAGCAGCACCGCGTGGTCCGGCAG
GAGAAGGAGGAGCTGCACAAGCAACTGGTTGAAGCCTCAGAGCGGTTGAAATCCCAGGCC
AAGGAACTCAAAGATGCCCATCAGCAGCGAAAGCTGGCCCTGCAGGAGTTCTCGGAGCTG
AACGAGCGCATGGCAGAGCTCCGTGCCCAGAAGCAGAAGGTGTCCCGGCAGCTGCGAGAC
AAGGAGGAGGAGATGGAGGTGGCCACGCAGAAGGTGGACGCCATGCGGCAGGAAATGCGG
AGAGCTGAGAAGCTCAGGAAAGAGCTGGAAGCTCAGCTTGATGATGCTGTTGCTGAGGCC
TCCAAGGAGCGCAAGCTTCGTGAGCACAGCGAGAACTTCTGCAAGCAAATGGAAAGCGAG
CTGGAGGCCCTCAAGGTGAAGCAAGGAGGCCGGGGAGCGGGTGCCACCTTAGAGCACCAG
CAAGAGATTTCCAAAATCAAATCCGAGCTGGAGAAGAAAGTCTTATTTTATGAAGAGGAA
TTGGTCAGACGTGAGGCCTCCCATGTGCTAGAAGTGAAAAATGTGAAGAAGGAGGTGCAT
GATTCAGAAAGCCACCAGCTGGCCCTGCAGAAAGAAATCTTGATGTTAAAAGATAAGTTA
GAAAAGTCAAAGCGAGAACGGCATAACGAGATGGAGGAGGCAGTAGGTACAATAAAAGAT
AAATACGAACGAGAAAGAGCGATGCTGTTTGATGAAAACAAGAAGCTAACTGCTGAAAAT
GAAAAGCTCTGTTCCTTTGTGGATAAACTCACAGCTCAAAATAGACAGCTGGAGGATGAG
CTGCAGGATCTGGCAGCCAAGAAGGAGTCAGTGGCCCACTGGGAAGCTCAGATTGCGGAA
ATCATTCAGTGGGTCAGTGACGAGAAAGATGCCCGGGGTTACCTTCAAGCTCTTGCTTCC
AAGATGACCGAAGAGCTCGAGGCTTTGAGGAGTTCTAGTCTGGGGTCAAGAACACTGGAC
CCGCTGTGGAAGGTGCGCCGCAGCCAGAAGCTGGACATGTCCGCGCGGCTGGAGCTGCAG
TCGGCCCTGGAGGCGGAGATCCGGGCCAAGCAGCTTGTCCAGGAGGAGCTCAGGAAGGTC
AAGGACGCCAACCTCACCTTGGAAAGCAAACTAAAGGATTCCGAAGCCAAAAACAGAGAA
TTATTAGAAGAAATGGAAATTTTGAAGAAAAAGATGGAAGAAAAATTCAGAGCAGATACT
GGGCTCAAACTTCCAGATTTTCAGGATTCCATTTTTGAGTATTTCAACACTGCTCCTCTT
GCACATGACCTGACATTTAGAACCAGCTCAGCTAGTGAGCAAGAAACACAAGCTCCGAAG
CCAGAAGCGTCCCCGTCGATGTCTGTGGCTGCATCAGAGCAGCAGGAGGACATGGCTCGG
CCCCCGCAGAGGCCATCCGCTGTGCCGTTGCCCACCACGCAGGCCCTGGCTCTGGCTGGA
CCGAAGCCAAAAGCTCACCAGTTCAGCATCAAGTCCTTCTCCAGCCCTACTCAGTGCAGC
CACTGCACCTCCCTGATGGTTGGGCTGATCCGGCAGGGCTACGCCTGCGAGGTGTGTTCC
TTTGCTTGCCACGTGTCCTGCAAAGACGGTGCCCCCCAGGTGTGCCCAATACCTCCCGAG
CAGTCCAAGAGGCCTCTGGGCGTGGACGTGCAGCGAGGCATCGGAACAGCCTACAAAGGC
CATGTCAAGGTCCCAAAGCCCACGGGGGTGAAGAAGGGATGGCAGCGCGCATATGCAGTC
GTCTGTGACTGCAAGCTCTTCCTGTATGATCTGCCTGAAGGAAAATCCACCCAGCCTGGT
GTCATTGCGAGCCAAGTCTTGGATCTCAGAGATGACGAGTTTTCCGTGAGCTCAGTCCTG
GCCTCAGATGTCATTCATGCTACACGCCGAGATATTCCATGTATATTCAGGGTGACGGCC
TCTCTCTTAGGTGCACCTTCTAAGACCAGCTCGCTGCTCATTCTGACAGAAAATGAGAAT
GAAAAGAGGAAGTGGGTTGGGATTCTAGAAGGACTCCAGTCCATCCTTCATAAAAACCGG
CTGAGGAATCAGGTCGTGCATGTTCCCTTGGAAGCCTACGACAGCTCGCTGCCTCTCATC
AAGGCCATCCTGACAGCTGCCATCGTGGATGCAGACAGGATTGCAGTCGGCCTAGAAGAA
GGGCTCTATGTCATAGAGGTCACCCGAGATGTGATCGTCCGTGCCGCTGACTGTAAGAAG
GTACACCAGATCGAGCTTGCTCCCAGGGAGAAGATCGTAATCCTCCTCTGTGGCCGGAAC
CACCATGTGCACCTCTATCCGTGGTCGTCCCTTGATGGAGCGGAAGGCAGCTTTGACATC
AAGCTTCCGGAAACCAAAGGCTGCCAGCTCATGGCCACGGCCACACTCAAGAGGAACTCT
GGCACCTGCCTGTTTGTGGCCGTGAAACGGCTGATCCTTTGCTATGAGATCCAGAGAACG
AAGCCATTCCACAGAAAGTTCAATGAGATTGTGGCTCCCGGCAGCGTGCAGTGCCTGGCG
GTGCTCAGGGACAGGCTCTGTGTGGGCTACCCTTCTGGGTTCTGCCTGCTGAGCATCCAG
GGGGACGGGCAGCCTCTAAACCTGGTAAATCCCAATGACCCCTCGCTTGCGTTCCTCTCA
CAACAGTCTTTTGATGCCCTTTGTGCTGTGGAGCTCGAAAGCGAGGAGTACCTGCTTTGC
TTCAGCCACATGGGACTGTACGTGGACCCGCAAGGCCGGAGGGCACGCGCGCAGGAGCTC
ATGTGGCCTGCGGCTCCTGTCGCCTGTAGTTGCAGCCCCACCCACGTCACGGTGTACAGC
GAGTATGGCGTGGACGTCTTTGATGTGCGCACCATGGAGTGGGTGCAGACCATCGGCCTG
CGGAGGATAAGGCCCCTGAACTCTGAAGGCACCCTCAACCTCCTCAACTGCGAGCCTCCA
CGCTTGATCTACTTCAAGAGCAAGTTCTCGGGAGCGGTTCTCAACGTGCCGGACACCTCC
GACAACAGCAAGAAGCAGATGCTGCGCACCAGGAGCAAAAGGCGGTTCGTCTTCAAGGTC
CCAGAGGAAGAGAGACTGCAGCAGAGGCGAGAGATGCTTAGAGACCCAGAATTGAGATCC
AAAATGATATCCAACCCAACCAACTTCAACCACGTGGCCCACATGGGCCCAGGCGACGGC
ATGCAGGTGCTCATGGACCTGCCTCTGAGTGCTGTGCCCCCCTCCCAGGAGGAAAGGCCG
GGCCCCGCTCCCACCAACCTGGCTCGCCAGCCTCCATCCAGGAACAAGCCCTACATCTCG
TGGCCCTCATCAGGTGGATCGGAGCCTAGCGTGACTGTGCCTCTGAGAAGTATGTCTGAT
CCAGACCAGGACTTTGACAAAGAGCCTGATTCGGACTCCACCAAACACTCAACTCCATCG
AATAGCTCCAACCCCAGCGGCCCACCGAGCCCCAACTCCCCCCACAGGAGCCAGCTCCCC
CTCGAAGGCCTGGAGCAGCCGGCCTGTGACACCTGA
Protein Properties
Number of Residues 1711
Molecular Weight 194313.6
Theoretical pI 6.31
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase MRCK beta
MSAKVRLKKLEQLLLDGPWRNESALSVETLLDVLVCLYTECSHSALRRDKYVAEFLEWAK
PFTQLVKEMQLHREDFEIIKVIGRGAFGEVAVVKMKNTERIYAMKILNKWEMLKRAETAC
FREERDVLVNGDCQWITALHYAFQDENHLYLVMDYYVGGDLLTLLSKFEDKLPEDMARFY
IGEMVLAIDSIHQLHYVHRDIKPDNVLLDVNGHIRLADFGSCLKMNDDGTVQSSVAVGTP
DYISPEILQAMEDGMGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHEERF
QFPSHVTDVSEEAKDLIQRLICSRERRLGQNGIEDFKKHAFFEGLNWENIRNLEAPYIPD
VSSPSDTSNFDVDDDVLRNTEILPPGSHTGFSGLHLPFIGFTFTTESCFSDRGSLKSIMQ
SNTLTKDEDVQRDLEHSLQMEAYERRIRRLEQEKLELSRKLQESTQTVQSLHGSSRALSN
SNRDKEIKKLNEEIERLKNKIADSNRLERQLEDTVALRQEREDSTQRLRGLEKQHRVVRQ
EKEELHKQLVEASERLKSQAKELKDAHQQRKLALQEFSELNERMAELRAQKQKVSRQLRD
KEEEMEVATQKVDAMRQEMRRAEKLRKELEAQLDDAVAEASKERKLREHSENFCKQMESE
LEALKVKQGGRGAGATLEHQQEISKIKSELEKKVLFYEEELVRREASHVLEVKNVKKEVH
DSESHQLALQKEILMLKDKLEKSKRERHNEMEEAVGTIKDKYERERAMLFDENKKLTAEN
EKLCSFVDKLTAQNRQLEDELQDLAAKKESVAHWEAQIAEIIQWVSDEKDARGYLQALAS
KMTEELEALRSSSLGSRTLDPLWKVRRSQKLDMSARLELQSALEAEIRAKQLVQEELRKV
KDANLTLESKLKDSEAKNRELLEEMEILKKKMEEKFRADTGLKLPDFQDSIFEYFNTAPL
AHDLTFRTSSASEQETQAPKPEASPSMSVAASEQQEDMARPPQRPSAVPLPTTQALALAG
PKPKAHQFSIKSFSSPTQCSHCTSLMVGLIRQGYACEVCSFACHVSCKDGAPQVCPIPPE
QSKRPLGVDVQRGIGTAYKGHVKVPKPTGVKKGWQRAYAVVCDCKLFLYDLPEGKSTQPG
VIASQVLDLRDDEFSVSSVLASDVIHATRRDIPCIFRVTASLLGAPSKTSSLLILTENEN
EKRKWVGILEGLQSILHKNRLRNQVVHVPLEAYDSSLPLIKAILTAAIVDADRIAVGLEE
GLYVIEVTRDVIVRAADCKKVHQIELAPREKIVILLCGRNHHVHLYPWSSLDGAEGSFDI
KLPETKGCQLMATATLKRNSGTCLFVAVKRLILCYEIQRTKPFHRKFNEIVAPGSVQCLA
VLRDRLCVGYPSGFCLLSIQGDGQPLNLVNPNDPSLAFLSQQSFDALCAVELESEEYLLC
FSHMGLYVDPQGRRARAQELMWPAAPVACSCSPTHVTVYSEYGVDVFDVRTMEWVQTIGL
RRIRPLNSEGTLNLLNCEPPRLIYFKSKFSGAVLNVPDTSDNSKKQMLRTRSKRRFVFKV
PEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERP
GPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTPS
NSSNPSGPPSPNSPHRSQLPLEGLEQPACDT
GenBank ID Protein 115527097
UniProtKB/Swiss-Prot ID Q9Y5S2
UniProtKB/Swiss-Prot Entry Name MRCKB_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_006035.3
GeneCard ID CDC42BPB
GenAtlas ID CDC42BPB
HGNC ID HGNC:1738
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  6. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  7. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  8. Hirosawa M, Nagase T, Ishikawa K, Kikuno R, Nomura N, Ohara O: Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain. DNA Res. 1999 Oct 29;6(5):329-36. [PubMed:10574461 ]
  9. Moncrieff CL, Bailey ME, Morrison N, Johnson KJ: Cloning and chromosomal localization of human Cdc42-binding protein kinase beta. Genomics. 1999 Apr 15;57(2):297-300. [PubMed:10198171 ]