Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08493
Secondary Accession Numbers
  • 14205
Name NTF2-related export protein 1
Synonyms
  1. Protein p15
Gene Name NXT1
Protein Type Unknown
Biological Properties
General Function Involved in transport
Specific Function Stimulator of protein export for NES-containing proteins. Also plays a role in the nuclear export of U1 snRNA, tRNA, and mRNA. The NXF1-NXT1 heterodimer is involved in the export of HSP70 mRNA in conjunction with THOC4 and THOC5
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Process
establishment of localization
transport
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:2
Locus 20p12-p11.2
SNPs NXT1
Gene Sequence
>423 bp
ATGGCATCTGTGGATTTCAAGACCTATGTGGATCAGGCCTGCAGAGCTGCTGAGGAGTTT
GTCAATGTCTACTACACCACCATGGATAAGCGGCGGCGTTTGCTGTCCCGCCTGTACATG
GGCACAGCCACCCTGGTCTGGAATGGCAATGCTGTTTCAGGACAAGAATCCTTGAGTGAG
TTTTTTGAAATGTTGCCTTCCAGCGAGTTCCAAATCAGCGTGGTAGACTGCCAGCCTGTT
CATGATGAAGCCACACCAAGCCAGACCACGGTCCTTGTTGTCATCTGTGGATCAGTGAAG
TTTGAGGGGAACAAACAACGGGACTTCAACCAGAACTTCATCCTGACCGCCCAGGCCTCA
CCCAGCAACACAGTGTGGAAGATCGCAAGTGACTGCTTCCGCTTCCAGGACTGGGCCAGC
TAG
Protein Properties
Number of Residues 140
Molecular Weight 15846.7
Theoretical pI 4.66
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>NTF2-related export protein 1
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE
FFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQAS
PSNTVWKIASDCFRFQDWAS
GenBank ID Protein 5880865
UniProtKB/Swiss-Prot ID Q9UKK6
UniProtKB/Swiss-Prot Entry Name NXT1_HUMAN
PDB IDs
GenBank Gene ID AF156957
GeneCard ID NXT1
GenAtlas ID NXT1
HGNC ID HGNC:15913
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052 ]
  3. Black BE, Levesque L, Holaska JM, Wood TC, Paschal BM: Identification of an NTF2-related factor that binds Ran-GTP and regulates nuclear protein export. Mol Cell Biol. 1999 Dec;19(12):8616-24. [PubMed:10567585 ]
  4. Ossareh-Nazari B, Maison C, Black BE, Levesque L, Paschal BM, Dargemont C: RanGTP-binding protein NXT1 facilitates nuclear export of different classes of RNA in vitro. Mol Cell Biol. 2000 Jul;20(13):4562-71. [PubMed:10848583 ]
  5. Guzik BW, Levesque L, Prasad S, Bor YC, Black BE, Paschal BM, Rekosh D, Hammarskjold ML: NXT1 (p15) is a crucial cellular cofactor in TAP-dependent export of intron-containing RNA in mammalian cells. Mol Cell Biol. 2001 Apr;21(7):2545-54. [PubMed:11259602 ]
  6. Katahira J, Inoue H, Hurt E, Yoneda Y: Adaptor Aly and co-adaptor Thoc5 function in the Tap-p15-mediated nuclear export of HSP70 mRNA. EMBO J. 2009 Mar 4;28(5):556-67. doi: 10.1038/emboj.2009.5. Epub 2009 Jan 22. [PubMed:19165146 ]
  7. Fribourg S, Braun IC, Izaurralde E, Conti E: Structural basis for the recognition of a nucleoporin FG repeat by the NTF2-like domain of the TAP/p15 mRNA nuclear export factor. Mol Cell. 2001 Sep;8(3):645-56. [PubMed:11583626 ]