You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08494
Secondary Accession Numbers
  • 14206
Name 2'-5'-oligoadenylate synthase 3
Synonyms
  1. (2-5')oligo(A) synthase 3
  2. 2-5A synthase 3
  3. p100 OAS
  4. p100OAS
Gene Name OAS3
Protein Type Unknown
Biological Properties
General Function Involved in RNA binding
Specific Function May play a role in mediating resistance to virus infection, control of cell growth, differentiation, and apoptosis. OAS3 synthesizes preferentially dimeric 2',5'-oligoadenylate molecules. GTP can be an alternative substrate
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
nucleotidyltransferase activity
nucleic acid binding
rna binding
Process
immune system process
immune response
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:1
Locus 12q24.2
SNPs OAS3
Gene Sequence
>3264 bp
ATGGACTTGTACAGCACCCCGGCCGCTGCGCTGGACAGGTTCGTGGCCAGAAAGCTGCAG
CCGCGGAAGGAGTTCGTAGAGAAGGCGCGGCGCGCTCTGGGCGCCCTGGCCGCTGCTCTG
AGGGAGCGCGGGGGCCGCCTCGGTGCTGCTGCCCCGCGGGTGCTGAAAACTGTCAAGGGA
GGCTCCTCGGGCCGGGGCACAGCTCTCAAGGGTGGCTGTGATTCTGAACTTGTCATCTTC
CTCGACTGCTTCAAGAGCTATGTGGACCAGAGGGCCCGCCGTGCAGAGATCCTCAGTGAG
ATGCGGGCATCGCTGGAATCCTGGTGGCAGAACCCAGTCCCTGGTCTGAGACTCACGTTT
CCTGAGCAGAGCGTGCCTGGGGCCCTGCAGTTCCGCCTGACATCCGTAGATCTTGAGGAC
TGGATGGATGTTAGCCTGGTGCCTGCCTTCAATGTCCTGGGTCAGGCCGGCTCCGGCGTC
AAACCCAAGCCACAAGTCTACTCTACCCTCCTCAACAGTGGCTGCCAAGGGGGCGAGCAT
GCGGCCTGCTTCACAGAGCTGCGGAGGAACTTTGTGAACATTCGCCCAGCCAAGTTGAAG
AACCTAATCTTGCTGGTGAAGCACTGGTACCACCAGGTGTGCCTACAGGGGTTGTGGAAG
GAGACGCTGCCCCCGGTCTATGCCCTGGAATTGCTGACCATCTTCGCCTGGGAGCAGGGC
TGTAAGAAGGATGCTTTCAGCCTAGCCGAAGGCCTCCGAACTGTCCTGGGCCTGATCCAA
CAGCATCAGCACCTGTGTGTTTTCTGGACTGTCAACTATGGCTTCGAGGACCCTGCAGTT
GGGCAGTTCTTGCAGCGGCAGCTTAAGAGACCCAGGCCTGTGATCCTGGACCCAGCTGAC
CCCACATGGGACCTGGGGAATGGGGCAGCCTGGCACTGGGATTTGCTAGCCCAGGAGGCA
GCATCCTGCTATGACCACCCATGCTTTCTGAGGGGGATGGGGGACCCAGTGCAGTCTTGG
AAGGGGCCGGGCCTTCCACGTGCTGGATGCTCAGGTTTGGGCCACCCCATCCAGCTAGAC
CCTAACCAGAAGACCCCTGAAAACAGCAAGAGCCTCAATGCTGTGTACCCAAGAGCAGGG
AGCAAACCTCCCTCATGCCCAGCTCCTGGCCCCACTGGGGCAGCCAGCATCGTCCCCTCT
GTGCCGGGAATGGCCTTGGACCTGTCTCAGATCCCCACCAAGGAGCTGGACCGCTTCATC
CAGGACCACCTGAAGCCGAGCCCCCAGTTCCAGGAGCAGGTGAAAAAGGCCATCGACATC
ATCTTGCGCTGCCTCCATGAGAACTGTGTTCACAAGGCCTCAAGAGTCAGTAAAGGGGGC
TCATTTGGCCGGGGCACAGACCTAAGGGATGGCTGTGATGTTGAACTCATCATCTTCCTC
AACTGCTTCACGGACTACAAGGACCAGGGGCCCCGCCGCGCAGAGATCCTTGATGAGATG
CGAGCGCACGTAGAATCCTGGTGGCAGGACCAGGTGCCCAGCCTGAGCCTTCAGTTTCCT
GAGCAGAATGTGCCTGAGGCTCTGCAGTTCCAGCTGGTGTCCACAGCCCTGAAGAGCTGG
ACGGATGTTAGCCTGCTGCCTGCCTTCGATGCTGTGGGGCAGCTCAGTTCTGGCACCAAA
CCAAATCCCCAGGTCTACTCAAGGCTCCTCACCAGTGGCTGCCAGGAGGGCGAGCATAAG
GCCTGCTTCGCAGAGCTGCGGAGGAACTTCATGAACATTCGCCCTGTCAAGCTGAAGAAC
CTGATTCTGCTGGTGAAGCACTGGTACCGCCAGGTTGCGGCTCAGAACAAAGGAAAAGGA
CCAGCCCCTGCCTCTCTGCCCCCAGCCTATGCCCTGGAGCTCCTCACCATCTTTGCCTGG
GAGCAGGGCTGCAGGCAGGATTGTTTCAACATGGCCCAAGGCTTCCGGACGGTGCTGGGG
CTCGTGCAACAGCATCAGCAGCTCTGTGTCTACTGGACGGTCAACTATAGCACTGAGGAC
CCAGCCATGAGAATGCACCTTCTTGGCCAGCTTCGAAAACCCAGACCCCTGGTCCTGGAC
CCCGCTGATCCCACCTGGAACGTGGGCCACGGTAGCTGGGAGCTGTTGGCCCAGGAAGCA
GCAGCGCTGGGGATGCAGGCCTGCTTTCTGAGTAGAGACGGGACATCTGTGCAGCCCTGG
GATGTGATGCCAGCCCTCCTTTACCAAACCCCAGCTGGGGACCTTGACAAGTTCATCAGT
GAATTTCTCCAGCCCAACCGCCAGTTCCTGGCCCAGGTGAACAAGGCCGTTGATACCATC
TGTTCATTTTTGAAGGAAAACTGCTTCCGGAATTCTCCCATCAAAGTGATCAAGGTGGTC
AAGGGTGGCTCTTCAGCCAAAGGCACAGCTCTGCGAGGCCGCTCAGATGCCGACCTCGTG
GTGTTCCTCAGCTGCTTCAGCCAGTTCACTGAGCAGGGCAACAAGCGGGCCGAGATCATC
TCCGAGATCCGAGCCCAGCTGGAGGCATGTCAACAGGAGCGGCAGTTCGAGGTCAAGTTT
GAAGTCTCCAAATGGGAGAATCCCCGCGTGCTGAGCTTCTCACTGACATCCCAGACGATG
CTGGACCAGAGTGTGGACTTTGATGTGCTGCCAGCCTTTGACGCCCTAGGCCAGCTGGTC
TCTGGCTCCAGGCCCAGCTCTCAAGTCTACGTCGACCTCATCCACAGCTACAGCAATGCG
GGCGAGTACTCCACCTGCTTCACAGAGCTACAACGGGACTTCATCATCTCTCGCCCTACC
AAGCTGAAGAGCCTGATCCGGCTGGTGAAGCACTGGTACCAGCAGTGTACCAAGATCTCC
AAGGGGAGAGGCTCCCTACCCCCACAGCACGGGCTGGAACTCCTGACTGTGTATGCCTGG
GAGCAGGGCCGGAAGGACTCCCAGTTCAACATGGCTGAGGGCTTCCGCACGGTCCTGGAG
CTGGTCACCCAGTACCGCCAGCTCTGTATCTACTGGACCATCAACTACAACGCCAAGGAC
AAGACTGTTGGAGACTTCCTGAAACAGCAGCTTCAGAAGCCCAGGCCTATCATCCTGGAT
CCGGCTGACCCGACAGGCAACCTGGGCCACAATGCCCGCTGGGACCTGCTGGCCAAGGAA
GCTGCAGCCTGCACATCTGCCCTGTGCTGCATGGGACGGAATGGCATCCCCATCCAGCCA
TGGCCAGTGAAGGCTGCTGTGTGA
Protein Properties
Number of Residues 1087
Molecular Weight 121164.1
Theoretical pI 8.47
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>2'-5'-oligoadenylate synthase 3
MDLYSTPAAALDRFVARRLQPRKEFVEKARRALGALAAALRERGGRLGAAAPRVLKTVKG
GSSGRGTALKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTF
PEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQAGSGVKPKPQVYSTLLNSGCQGGEH
AACFTELRRNFVNIRPAKLKNLILLVKHWYHQVCLQGLWKETLPPVYALELLTIFAWEQG
CKKDAFSLAEGLRTVLGLIQQHQHLCVFWTVNYGFEDPAVGQFLQRQLKRPRPVILDPAD
PTWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGCSGLGHPIQLD
PNQKTPENSKSLNAVYPRAGSKPPSCPAPGPTGAASIVPSVPGMALDLSQIPTKELDRFI
QDHLKPSPQFQEQVKKAIDIILRCLHENCVHKASRVSKGGSFGRGTDLRDGCDVELIIFL
NCFTDYKDQGPRRAEILDEMRAHVESWWQDQVPSLSLQFPEQNVPEALQFQLVSTALKSW
TDVSLLPAFDAVGQLSSGTKPNPQVYSRLLTSGCQEGEHKACFAELRRNFMNIRPVKLKN
LILLVKHWYRQVAAQNKGKGPAPASLPPAYALELLTIFAWEQGCRQDCFNMAQGFRTVLG
LVQQHQQLCVYWTVNYSTEDPAMRMHLLGQLRKPRPLVLDPADPTWNVGHGSWELLAQEA
AALGMQACFLSRDGTSVQPWDVMPALLYQTPAGDLDKFISEFLQPNRQFLAQVNKAVDTI
CSFLKENCFRNSPIKVIKVVKGGSSAKGTALRGRSDADLVVFLSCFSQFTEQGNKRAEII
SEIRAQLEACQQERQFEVKFEVSKWENPRVLSFSLTSQTMLDQSVDFDVLPAFDALGQLV
SGSRPSSQVYVDLIHSYSNAGEYSTCFTELQRDFIISRPTKLKSLIRLVKHWYQQCTKIS
KGRGSLPPQHGLELLTVYAWEQGGKDSQFNMAEGFRTVLELVTQYRQLCIYWTINYNAKD
KTVGDFLKQQLQKPRPIILDPADPTGNLGHNARWDLLAKEAAACTSALCCMGRNGIPIQP
WPVKAAV
GenBank ID Protein 11527773
UniProtKB/Swiss-Prot ID Q9Y6K5
UniProtKB/Swiss-Prot Entry Name OAS3_HUMAN
PDB IDs Not Available
GenBank Gene ID AB044545
GeneCard ID OAS3
GenAtlas ID OAS3
HGNC ID HGNC:8088
References
General References
  1. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075 ]
  2. Ito M, Shichijo S, Tsuda N, Ochi M, Harashima N, Saito N, Itoh K: Molecular basis of T cell-mediated recognition of pancreatic cancer cells. Cancer Res. 2001 Mar 1;61(5):2038-46. [PubMed:11280764 ]
  3. Rebouillat D, Hovnanian A, Marie I, Hovanessian AG: The 100-kDa 2',5'-oligoadenylate synthetase catalyzing preferentially the synthesis of dimeric pppA2'p5'A molecules is composed of three homologous domains. J Biol Chem. 1999 Jan 15;274(3):1557-65. [PubMed:9880533 ]
  4. Rebouillat D, Hovnanian A, David G, Hovanessian AG, Williams BR: Characterization of the gene encoding the 100-kDa form of human 2',5' oligoadenylate synthetase. Genomics. 2000 Dec 1;70(2):232-40. [PubMed:11112351 ]