You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08497
Secondary Accession Numbers
  • 14209
Name Phosphatidylinositol 4-kinase type 2-beta
Synonyms
  1. PI4KII-BETA
  2. Phosphatidylinositol 4-kinase type II-beta
Gene Name PI4K2B
Protein Type Unknown
Biological Properties
General Function Involved in phosphotransferase activity, alcohol group as acceptor
Specific Function Together with PI4K2A and the type III PI4Ks (PIK4CA and PIK4CB) it contributes to the overall PI4-kinase activity of the cell. This contribution may be especially significant in plasma membrane, endosomal and Golgi compartments. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Contributes to the production of InsP3 in stimulated cells and is likely to be involved in the regulation of vesicular trafficking
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
phosphotransferase activity, alcohol group as acceptor
Cellular Location
  1. Cytoplasm
  2. Membrane
Gene Properties
Chromosome Location Chromosome:4
Locus 4p15.2
SNPs PI4K2B
Gene Sequence
>1446 bp
ATGGAGGATCCCTCCGAGCCCGACCGGTTGGCGTCCGCGGACGGCGGGAGCCCGGAGGAG
GAGGAGGATGGGGAGCGGGAGCCGCTGCTACCGCGGATCGCCTGGGCCCACCCGCGGAGA
GGCGCCCCAGGCAGCGCCGTGAGGCTGCTGGACGCTGCCGGGGAGGAGGGCGAGGCCGGC
GACGAGGAGCTGCCCCTCCCGCCCGGGGACGTGGGGGTCTCCCGGAGTTCGCCCGCCGAG
CTGGACCGGAGCCGCCCCGCGGTTTCAGTAACTATTGGTACTTCAGAGATGAATGCATTC
TTGGATGACCCAGAATTTGCTGATATTATGCTGAGAGCAGAGCAAGCAATAGAAGTTGGA
ATTTTTCCAGAAAGAATCTCTCAAGGTTCAAGTGGAAGTTACTTTGTGAAGGATCCTAAG
AGGAAAATTATTGGTGTGTTTAAACCCAAATCAGAAGAGCCTTATGGTCAACTCAATCCA
AAATGGACCAAATATGTCCATAAGGTCTGCTGCCCTTGCTGCTTTGGCCGAGGCTGCCTG
ATTCCTAATCAGGGGTACCTTTCCGAAGCGGGTGCCTATCTTGTGGACAACAAGCTTCAT
CTGAGCATTGTACCTAAAACAAAGGTGGTTTGGCTTGTCAGTGAGACATTTAACTATAAT
GCGATTGACCGTGCAAAATCAAGAGGCAAAAAGTATGCTTTAGAAAAAGTGCCAAAAGTG
GGTAGAAAGTTTCATAGGATAGGACTCCCTCCTAAGATTGGTTCCTTTCAGTTATTTGTT
GAAGGTTACAAGGAGGCTGAATATTGGCTTAGGAAATTTGAAGCTGACCCTTTGCCTGAG
AATATTAGAAAACAATTTCAGTCACAATTTGAAAGATTAGTTATTTTGGATTACATCATC
AGAAATACAGACAGGGGCAATGATAATTGGTTAGTCAGATACGAAAAGCAGAAATGTGAA
AAGGAAATTGACCATAAGGAATCAAAATGGATTGATGATGAAGAATTCCTTATTAAAATA
GCTGCAATTGATAATGGTCTAGCATTTCCTTTTAAACATCCTGATGAATGGAGAGCATAT
CCATTTCACTGGGCTTGGCTTCCTCAAGCAAAAGTTCCCTTTTCTGAAGAAATAAGAAAT
TTGATTCTACCATATATTTCTGACATGAACTTTGTGCAAGATTTATGTGAAGATCTCTAT
GAACTTTTTAAGACTGACAAAGGATTTGACAAAGCCACTTTTGAAAGTCAGATGTCTGTG
ATGAGGGGTCAGATCTTAAACCTTACTCAGGCATTGAGAGACGGGAAGAGTCCTTTCCAG
CTAGTACAGATACCTTGTGTGATTGTGGAACGCAGTCAAGGTGGAAGTCAGGGTCGGATT
GTCCACCTGAGCAATTCCTTTACCCAGACTGTCAATTGCAGGAAGCCATTTTTTTCCTCC
TGGTAG
Protein Properties
Number of Residues 481
Molecular Weight 54743.7
Theoretical pI 5.77
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Phosphatidylinositol 4-kinase type 2-beta
MEDPSEPDRLASADGGSPEEEEDGEREPLLPRIAWAHPRRGAPGSAVRLLDAAGEEGEAG
DEELPLPPGDVGVSRSSSAELDRSRPAVSVTIGTSEMNAFLDDPEFADIMLRAEQAIEVG
IFPERISQGSSGSYFVKDPKRKIIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCL
IPNQGYLSEAGAYLVDNKLHLSIVPKTKVVWLVSETFNYNAIDRAKSRGKKYALEKVPKV
GRKFHRIGLPPKIGSFQLFVEGYKEAEYWLRKFEADPLPENIRKQFQSQFERLVILDYII
RNTDRGNDNWLVRYEKQKCEKEIDHKESKWIDDEEFLIKIAAIDNGLAFPFKHPDEWRAY
PFHWAWLPQAKVPFSEEIRNLILPYISDMNFVQDLCEDLYELFKTDKGFDKATFESQMSV
MRGQILNLTQALRDGKSPFQLVQIPCVIVERSQGGSQGRIVHLSNSFTQTVNCRKPFFSS
W
GenBank ID Protein 15625544
UniProtKB/Swiss-Prot ID Q8TCG2
UniProtKB/Swiss-Prot Entry Name P4K2B_HUMAN
PDB IDs Not Available
GenBank Gene ID AF411320
GeneCard ID PI4K2B
GenAtlas ID PI4K2B
HGNC ID HGNC:18215
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Balla A, Tuymetova G, Barshishat M, Geiszt M, Balla T: Characterization of type II phosphatidylinositol 4-kinase isoforms reveals association of the enzymes with endosomal vesicular compartments. J Biol Chem. 2002 May 31;277(22):20041-50. Epub 2002 Mar 28. [PubMed:11923287 ]
  5. Wei YJ, Sun HQ, Yamamoto M, Wlodarski P, Kunii K, Martinez M, Barylko B, Albanesi JP, Yin HL: Type II phosphatidylinositol 4-kinase beta is a cytosolic and peripheral membrane protein that is recruited to the plasma membrane and activated by Rac-GTP. J Biol Chem. 2002 Nov 29;277(48):46586-93. Epub 2002 Sep 24. [PubMed:12324459 ]