Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08502
Secondary Accession Numbers
  • 14214
Name Partitioning defective 6 homolog gamma
Synonyms
  1. PAR-6 gamma
  2. PAR6D
Gene Name PARD6G
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Adapter protein involved in asymmetrical cell division and cell polarization processes. May play a role in the formation of epithelial tight junctions. The PARD6-PARD3 complex links GTP- bound Rho small GTPases to atypical protein kinase C proteins
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
Cellular Location
  1. Cell membrane
  2. Cytoplasm
  3. Cell junction
  4. tight junction
Gene Properties
Chromosome Location Chromosome:1
Locus 18q23
SNPs PARD6G
Gene Sequence
>1131 bp
ATGAACCGAAGTTTTCACAAGTCTCAGACCTTGCGATTCTACGATTGCAGCGCAGTGGAA
GTCAAGAGCAAGTTTGGGGCGGAATTCCGAAGGTTCTCTCTGGACCGTCATAAGCCTGGG
AAGTTTGAAGATTTCTACAAGCTGGTTGTGCACACCCACCATATCTCCAACAGTGATGTA
ACTATTGGCTATGCAGATGTGCACGGAGACCTGCTGCCCATCAACAATGATGACAACTTC
TGCAAGGCGGTTTCTAGTGCAAATCCCCTGCTCAGGGTCTTCATCCAGAAACGAGAGGAG
GCCGAGCGTGGCAGCCTCGGCGCGGGCTCGCTGTGCAGGCGGAGGCGGGCGCTGGGCGCG
CTGCGTGATGAAGGACCCCGGCGGCGTGCACACCTGGACATCGGCCTCCCGCGCGACTTC
CGCCCCGTATCATCCATCATCGATGTGGACCTGGTCCCCGAGACGCACCGGCGAGTGCGG
CTGCACCGGCACGGCTGCGAGAAGCCGCTGGGCTTCTACATCCGCGATGGCGCCAGCGTG
CGCGTGACCCCGCACGGGCTGGAGAAGGTGCCCGGCATCTTCATCTCGCGCATGGTACCC
GGGGGCCTGGCGGAGAGCACCGGGCTGCTGGCTGTGAATGACGAGGTCCTGGAGGTGAAC
GGCATTGAGGTGGCCGGGAAGACGCTGGACCAGGTCACGGACATGATGATCGCCAACAGC
CACAACCTCATCGTCACCGTCAAGCCCGCCAACCAGCGCAACAACGTGGTGCGCGGCGGC
CGCGCGTTGGGCAGCTCGGGACCGCCCTCGGACGGCACCGCGGGCTTCGTGGGTCCCCCC
GCCCCGCGCGTCCTGCAGAACTTCCACCCCGACGAGGCGGAGAGCGATGAGGACAACGAC
GTCGTCATCGAGGGCACACTGGAGCCTGCACGTCCCCCCCAGACCCCGGGCGCGCCCGCA
GGCAGCCTCTCCCGGGTCAATGGCGCGGGCCTGGCGCAGCGGCTGCAGCGGGACCTGGCC
CTGGACGGCGGCCTCCAGCGGCTGCTCAGCTCCCTGCGGGCCGACCCCCGTCACAGCCTG
GCGCTGCCGCCAGGCGGCGTGGAGGAGCACGGGCCCGCGGTCACGCTCTAG
Protein Properties
Number of Residues 376
Molecular Weight 40882.9
Theoretical pI 8.37
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Partitioning defective 6 homolog gamma
MNRSFHKSQTLRFYDCSAVEVKSKFGAEFRRFSLDRHKPGKFEDFYKLVVHTHHISNSDV
TIGYADVHGDLLPINNDDNFCKAVSSANPLLRVFIQKREEAERGSLGAGSLCRRRRALGA
LRDEGPRRRAHLDIGLPRDFRPVSSIIDVDLVPETHRRVRLHRHGCEKPLGFYIRDGASV
RVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVNGIEVAGKTLDQVTDMMIANS
HNLIVTVKPANQRNNVVRGGRALGSSGPPSDGTAGFVGPPAPRVLQNFHPDEAESDEDND
VVIEGTLEPARPPQTPGAPAGSLSRVNGAGLAQRLQRDLALDGGLQRLLSSLRADPRHSL
ALPPGGVEEHGPAVTL
GenBank ID Protein 13537119
UniProtKB/Swiss-Prot ID Q9BYG4
UniProtKB/Swiss-Prot Entry Name PAR6G_HUMAN
PDB IDs
GenBank Gene ID AB044556
GeneCard ID PARD6G
GenAtlas ID PARD6G
HGNC ID HGNC:16076
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Noda Y, Takeya R, Ohno S, Naito S, Ito T, Sumimoto H: Human homologues of the Caenorhabditis elegans cell polarity protein PAR6 as an adaptor that links the small GTPases Rac and Cdc42 to atypical protein kinase C. Genes Cells. 2001 Feb;6(2):107-19. [PubMed:11260256 ]
  3. Joberty G, Petersen C, Gao L, Macara IG: The cell-polarity protein Par6 links Par3 and atypical protein kinase C to Cdc42. Nat Cell Biol. 2000 Aug;2(8):531-9. [PubMed:10934474 ]