Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08503
Secondary Accession Numbers
  • 14215
Name Partitioning defective 3 homolog
Synonyms
  1. ASIP
  2. Atypical PKC isotype-specific-interacting protein
  3. CTCL tumor antigen se2-5
  4. PAR-3
  5. PAR3-alpha
  6. PARD-3
Gene Name PARD3
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Adapter protein involved in asymmetrical cell division and cell polarization processes. Seems to play a central role in the formation of epithelial tight junctions. Targets the phosphatase PTEN to cell junctions. Association with PARD6B may prevent the interaction of PARD3 with F11R/JAM1, thereby preventing tight junction assembly. The PARD6-PARD3 complex links GTP-bound Rho small GTPases to atypical protein kinase C proteins. Required for establishment of neuronal polarity and normal axon formation in cultured hippocampal neurons
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
Cellular Location
  1. Cell membrane
  2. Cytoplasm
  3. Cytoplasm
  4. Endomembrane system
  5. cytoskeleton
  6. Cell junction
  7. Cell junction
  8. tight junction
  9. cell cortex
Gene Properties
Chromosome Location Chromosome:1
Locus 10p11.21
SNPs PARD3
Gene Sequence
>4071 bp
ATGAAAGTGACCGTGTGCTTCGGACGGACCCGGGTGGTCGTGCCGTGCGGGGACGGCCAC
ATGAAAGTTTTCAGCCTCATCCAGCAGGCGGTGACCCGCTACCGGAAGGCCATCGCCAAG
GATCCAAACTACTGGATACAGGTGCATCGCTTGGAACATGGAGATGGAGGAATACTAGAC
CTTGATGACATTCTTTGTGATGTAGCAGACGATAAAGACAGACTGGTAGCAGTGTTTGAT
GAGCAGGATCCACATCACGGAGGTGATGGCACCAGTGCCAGTTCCACGGGTACCCAGAGC
CCAGAGATATTTGGTAGTGAGCTTGGCACCAACAATGTCTCAGCCTTTCAGCCTTACCAA
GCAACAAGTGAAATTGAGGTCACACCTTCAGTCCTTCGAGCAAATATGCCTCTTCATGTT
CGACGCAGTAGTGACCCAGCTCTAATTGGCCTCTCCACTTCTGTCAGTGATAGTAATTTT
TCCTCTGAAGAGCCTTCAAGGAAAAATCCCACACGCTGGTCAACAACAGCTGGCTTCCTC
AAGCAGAACACTGCTGGGAGTCCTAAAACCTGCGACAGGAAGAAAGATGAAAACTACAGA
AGCCTCCCGCGGGATACTAGTAACTGGTCTAACCAATTTCAGAGAGACAATGCTCGCTCG
TCTCTGAGTGCCAGTCACCCAATGGTGGGCAAGTGGCTGGAGAAACAAGAACAGGATGAG
GATGGGACAGAAGAGGATAACAGTCGTGTTGAACCTGTTGGACATGCTGACACGGGTTTG
GAGCATATACCCAACTTTTCTCTGGATGATATGGTAAAGCTCGTAGAAGTCCCCAACGAT
GGAGGGCCTCTGGGAATCCATGTAGTGCCTTTCAGTGCTCGAGGCGGCAGAACCCTGGGG
TTATTAGTAAAACGATTGGAGAAAGGTGGTAAAGCTGAACATGAAAATCTTTTTCGTGAG
AATGATTGCATTGTCAGGATTAATGATGGCGACCTTCGAAATAGAAGATTTGAACAAGCA
CAACATATGTTTCGCCAAGCCATGCGTACACCCATCATTTGGTTCCATGTGGTTCCTGCA
GCAAATAAAGAGCAGTATGAACAACTATCCCAAAGTGAGAAGAACAATTACTATTCAAGC
CGTTTTAGCCCTGACAGCCAGTATATTGACAACAGGAGTGTGAACAGTGCAGGGCTTCAC
ACGGTGCAGAGAGCACCCCGACTGAACCACCCGCCTGAGCAGATAGACTCTCACTCAAGA
CTACCTCATAGCGCACACCCCTCGGGAAAACCACCATCCGCTCCAGCCTCGGCACCTCAG
AATGTATTTAGTACGACTGTAAGCAGTGGTTATAACACCAAAAAAATAGGCAAGAGGCTT
AATATCCAGCTTAAGAAAGGTACAGAAGGTTTGGGATTCAGCATCACTTCCAGAGATGTA
ACAATAGGTGGCTCAGCTCCAATCTATGTGAAAAACATTCTCCCCCGGGGGGCGGCCATT
CAGGATGGCCGACTTAAGGCAGGAGACAGACTTATAGAGGTAAATGGAGTAGATTTAGTG
GGCAAATCCCAAGAGGAAGTTGTTTCGCTGTTGAGAAGCACCAAGATGGAAGGAACTGTG
AGCCTTCTGGTCTTTCGCCAGGAAGACGCCTTCCACCCAAGGGAACTGAATGCAGAGCCA
AGCCAGATGCAGATTCCAAAAGAAACGAAAGCAGAAGATGAGGATATTGTTCTTACACCT
GATGGCACCAGGGAATTTCTGACATTTGAAGTCCCACTTAATGATTCAGGATCTGCAGGC
CTTGGTGTCAGTGTCAAAGGTAACCGGTCAAAAGAGAACCACGCAGATTTGGGAATCTTT
GTCAAGTCCATTATTAATGGAGGAGCAGCATCTAAAGATGGAAGGCTTCGGGTGAATGAT
CAACTGATAGCAGTAAATGGAGAATCCCTGTTGGGCAAGACAAACCAAGATGCCATGGAA
ACCCTAAGAAGGTCTATGTCTACTGAAGGCAATAAACGAGGAATGATCCAGCTTATTGTT
GCAAGGAGAATAAGCAAGTGCAATGAGCTGAAGTCACCTGGGAGCCCCCCTGGACCTGAG
CTGCCCATTGAAACAGCGTTGGATGATAGAGAACGAAGAATTTCCCATTCCCTCTACAGT
GGGATTGAGGGGCTTGATGAATCGCCCAGCAGAAATGCTGCCCTCAGTAGGATAATGGGT
GAGTCAGGTAAATACCAGCTGTCCCCTACAGTGAATATGCCCCAAGATGACACTGTCATT
ATAGAAGATGACAGGTTGCCAGTGCTTCCTCCACATCTCTCTGACCAGTCCTCTTCCAGC
TCCCATGATGATGTGGGGTTTGTGACGGCAGATGCTGGTACTTGGGCCAAGGCTGCAATC
AGTGATTCAGCCGACTGCTCTTTGAGTCCAGATGTTGATCCAGTTCTTGCTTTTCAACGA
GAAGGATTTGGACGTCAGAGTATGTCAGAAAAACGCACAAAGCAATTTTCAGATGCCAGT
CAATTGGATTTCGTTAAAACACGAAAATCAAAAAGCATGGATTTAGGTATAGCTGACGAG
ACTAAACTCAATACAGTGGATGACCAGAAAGCAGGTTCTCCCAGCAGAGATGTGGGTCCT
TCCCTGGGTCTGAAGAAGTCAAGCTCGTTGGAGAGTCTGCAGACCGCAGTTGCCGAGGTG
ACTTTGAATGGGGATATTCCTTTCCATCGTCCACGGCCGCGGATAATCAGAGGCAGGGGA
TGCAATGAGAGCTTCAGAGCTGCCATCGACAAATCTTATGATAAACCCGCGGTAGATGAT
GATGATGAAGGCATGGAGACCTTGGAAGAAGACACAGAAGAAAGTTCAAGATCAGGGAGA
GAGTCTGTATCCACAGCCAGTGATCAGCCTTCCCACTCTCTGGAGAGACAAATGAATGGA
AACCAAGAGAAAGGTGATAAGACTGATAGAAAAAAGGATAAAACTGGAAAAGAAAAGAAG
AAAGATAGAGATAAGGAGAAGGATAAAATGAAAGCCAAGAAGGGAATGCTGAAGGGCTTG
GGAGACATGTTCAGGTTTGGCAAACATCGAAAAGATGACAAGATTGAGAAAACGGGTAAA
ATAAAAATACAGGAATCCTTTACATCAGAAGAGGAGAGGATACGAATGAAGCAGGAGCAG
GAGAGGATTCAAGCCAAAACTCGAGAATTTAGGGAACGACAAGCTCGAGAGCGTGACTAT
GCTGAAATTCAAGATTTTCATCGGACATTTGGCTGTGATGATGAGTTAATGTATGGGGGA
GTTTCTTCTTATGAAGGTTCCATGGCTCTCAACGCTAGACCTCAGAGCCCACGAGAAGGG
CATATGATGGATGCTTTGTATGCCCAAGTCAAGAAGCCGCGGAATTCCAAACCCTCACCT
GTAGACAGTAACAGATCAACTCCTAGCAATCATGATCGGATACAGCGTCTGAGGCAAGAA
TTTCAGCAAGCAAAGCAAGATGAAGATGTAGAAGATCGTCGGCGGACCTATAGTTTTGAG
CAACCCTGGCCGAACGCACGGCCGGCGACGCAGAGCGGGCGACACTCGGTGTCCGTGGAG
GTGCAGATGCAGCGGCAGCGGCAGGAGGAGCGCGAGAGCTCCCAGCAGGCCCAGCGCCAG
TACAGCTCTCTGCCTCGGCAAAGCAGGAAAAATGCCAGCTCGGTCTCCCAGGACTCTTGG
GAGCAGAACTACTCCCCTGGGGAAGGCTTCCAGAGTGCCAAAGAGAACCCCAGGTACTCC
AGCTACCAAGGCTCCAGGAACGGCTACCTGGGAGGACATGGCTTCAACGCCAGGGTCATG
CTGGAAACTCAGGAGCTCCTTCGCCAGGAACAGAGGCGGAAGGAGCAGCAGATGAAGAAG
CAGCCTCCTTCCGAGGGGCCCAGCAACTATGACTCGTATAAGAAAGTCCAGGACCCCAGT
TACGCCCCTCCCAAGGGGCCCTTCCGGCAAGATGTGCCCCCCTCCCCTTCTCAGGTTGCG
AGGCTGAACAGACTTCAGACTCCTGAGAAAGGGAGGCCCTTCTATTCCTGA
Protein Properties
Number of Residues 1356
Molecular Weight 151422.0
Theoretical pI 7.75
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Partitioning defective 3 homolog
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILD
LDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQ
ATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVGKWLEKQEQDE
DGTEEDNSRVEPVGHADTGLEHIPNFSLDDMVKLVEVPNDGGPLGIHVVPFSARGGRTLG
LLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPA
ANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSR
LPHSAHPSGKPPSAPASAPQNVFSTTVSSGYNTKKIGKRLNIQLKKGTEGLGFSITSRDV
TIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTV
SLLVFRQEDAFHPRELNAEPSQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAG
LGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKTNQDAME
TLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPELPIETALDDRERRISHSLYS
GIEGLDESPSRNAALSRIMGESGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSS
SHDDVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDAS
QLDFVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEV
TLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETLEEDTEESSRSGR
ESVSTASDQPSHSLERQMNGNQEKGDKTDRKKDKTGKEKKKDRDKEKDKMKAKKGMLKGL
GDMFRFGKHRKDDKIEKTGKIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARERDY
AEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSP
VDSNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQPWPNARPATQSGRHSVSVE
VQMQRQRQEERESSQQAQRQYSSLPRQSRKNASSVSQDSWEQNYSPGEGFQSAKENPRYS
SYQGSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQMKKQPPSEGPSNYDSYKKVQDPS
YAPPKGPFRQDVPPSPSQVARLNRLQTPEKGRPFYS
GenBank ID Protein 21361831
UniProtKB/Swiss-Prot ID Q8TEW0
UniProtKB/Swiss-Prot Entry Name PARD3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_019619.3
GeneCard ID PARD3
GenAtlas ID PARD3
HGNC ID HGNC:16051
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  6. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  7. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  8. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  9. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  10. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  11. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  12. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  13. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  14. Wang Y, Du D, Fang L, Yang G, Zhang C, Zeng R, Ullrich A, Lottspeich F, Chen Z: Tyrosine phosphorylated Par3 regulates epithelial tight junction assembly promoted by EGFR signaling. EMBO J. 2006 Nov 1;25(21):5058-70. Epub 2006 Oct 19. [PubMed:17053785 ]
  15. Zhang Y, Wolf-Yadlin A, Ross PL, Pappin DJ, Rush J, Lauffenburger DA, White FM: Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules. Mol Cell Proteomics. 2005 Sep;4(9):1240-50. Epub 2005 Jun 11. [PubMed:15951569 ]
  16. Heibeck TH, Ding SJ, Opresko LK, Zhao R, Schepmoes AA, Yang F, Tolmachev AV, Monroe ME, Camp DG 2nd, Smith RD, Wiley HS, Qian WJ: An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells. J Proteome Res. 2009 Aug;8(8):3852-61. doi: 10.1021/pr900044c. [PubMed:19534553 ]
  17. Wolf-Yadlin A, Hautaniemi S, Lauffenburger DA, White FM: Multiple reaction monitoring for robust quantitative proteomic analysis of cellular signaling networks. Proc Natl Acad Sci U S A. 2007 Apr 3;104(14):5860-5. Epub 2007 Mar 26. [PubMed:17389395 ]
  18. Khazaei MR, Puschel AW: Phosphorylation of the par polarity complex protein Par3 at serine 962 is mediated by aurora a and regulates its function in neuronal polarity. J Biol Chem. 2009 Nov 27;284(48):33571-9. doi: 10.1074/jbc.M109.055897. Epub 2009 Oct 6. [PubMed:19812038 ]
  19. Gao L, Macara IG, Joberty G: Multiple splice variants of Par3 and of a novel related gene, Par3L, produce proteins with different binding properties. Gene. 2002 Jul 10;294(1-2):99-107. [PubMed:12234671 ]
  20. Suzuki A, Yamanaka T, Hirose T, Manabe N, Mizuno K, Shimizu M, Akimoto K, Izumi Y, Ohnishi T, Ohno S: Atypical protein kinase C is involved in the evolutionarily conserved par protein complex and plays a critical role in establishing epithelia-specific junctional structures. J Cell Biol. 2001 Mar 19;152(6):1183-96. [PubMed:11257119 ]
  21. Johansson A, Driessens M, Aspenstrom P: The mammalian homologue of the Caenorhabditis elegans polarity protein PAR-6 is a binding partner for the Rho GTPases Cdc42 and Rac1. J Cell Sci. 2000 Sep;113 ( Pt 18):3267-75. [PubMed:10954424 ]
  22. Joberty G, Petersen C, Gao L, Macara IG: The cell-polarity protein Par6 links Par3 and atypical protein kinase C to Cdc42. Nat Cell Biol. 2000 Aug;2(8):531-9. [PubMed:10934474 ]
  23. Fang CM, Xu YH: Down-regulated expression of atypical PKC-binding domain deleted asip isoforms in human hepatocellular carcinomas. Cell Res. 2001 Sep;11(3):223-9. [PubMed:11642408 ]
  24. Kohjima M, Noda Y, Takeya R, Saito N, Takeuchi K, Sumimoto H: PAR3beta, a novel homologue of the cell polarity protein PAR3, localizes to tight junctions. Biochem Biophys Res Commun. 2002 Dec 13;299(4):641-6. [PubMed:12459187 ]
  25. Eichmuller S, Usener D, Dummer R, Stein A, Thiel D, Schadendorf D: Serological detection of cutaneous T-cell lymphoma-associated antigens. Proc Natl Acad Sci U S A. 2001 Jan 16;98(2):629-34. Epub 2001 Jan 9. [PubMed:11149944 ]
  26. Wells CD, Fawcett JP, Traweger A, Yamanaka Y, Goudreault M, Elder K, Kulkarni S, Gish G, Virag C, Lim C, Colwill K, Starostine A, Metalnikov P, Pawson T: A Rich1/Amot complex regulates the Cdc42 GTPase and apical-polarity proteins in epithelial cells. Cell. 2006 May 5;125(3):535-48. [PubMed:16678097 ]