Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08508
Secondary Accession Numbers
  • 14220
Name Ras-related protein Rab-15
Synonyms Not Available
Gene Name RAB15
Protein Type Unknown
Biological Properties
General Function Involved in GTP binding
Specific Function May act in concert with RAB3A in regulating aspects of synaptic vesicle membrane flow within the nerve terminal
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
Process
establishment of localization
transport
protein transport
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signal transduction
small gtpase mediated signal transduction
Cellular Location
  1. Cell membrane
  2. Lipid-anchor
  3. Cytoplasmic side (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 14q23.3
SNPs RAB15
Gene Sequence
>627 bp
ATGGCGAAGCAGTACGATGTGCTGTTCCGGCTGCTGCTGATCGGGGACTCCGGGGTGGGC
AAGACCTGCCTGCTGTGCCGCTTCACCGACAACGAGTTCCACTCCTCGCACATCTCCACC
ATCGGTGTTGACTTTAAGATGAAGACCATAGAGGTAGACGGCATCAAAGTGCGGATACAG
ATCTGGGACACTGCAGGGCAGGAGAGATACCAGACCATCACAAAGCAGTACTATCGGCGG
GCCCAGGGGATATTTTTGGTCTATGACATTAGCAGCGAGCGCTCTTACCAGCACATCATG
AAGTGGGTCAGTGACGTGGATGAGGTAGGAGATGCCACCTCACTGCCGGGGTGTGGAGAG
GGTGCCTCACCGGGGAAGGCAAGGCGAGGGCCAGATGGGAAGGCAAATGCTTCCAGGAAG
CTTTGCCTTCCACAGCCCTGGATGAAGACCTCTGGTACGCACCAGAAGGCGTCCAGAAGA
TCCTTATTGGGAATAAGGCTGATGAGGAGCAGAAACGGCAGGTGGGAAGAGAGCAAGGGC
AGCAGCTGGCGAAGGAGTATGGCATGGACTTCTATGAAACAAGTGCCTGCACCAACCTCA
ACATTAAAGAGTCATTCACGCGTCTGA
Protein Properties
Number of Residues 212
Molecular Weight 24390.5
Theoretical pI 5.43
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ras-related protein Rab-15
MAKQYDVLFRLLLIGDSGVGKTCLLCRFTDNEFHSSHISTIGVDFKMKTIEVDGIKVRIQ
IWDTAGQERYQTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIG
NKADEEQKRQVGREQGQQLAKEYGMDFYETSACTNLNIKESFTRLTELVLQAHRKELEGL
RMRASNELALAELEEEEGKPEGPANSSKTCWC
GenBank ID Protein 38371739
UniProtKB/Swiss-Prot ID P59190
UniProtKB/Swiss-Prot Entry Name RAB15_HUMAN
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID RAB15
GenAtlas ID RAB15
HGNC ID HGNC:20150
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121 ]
  3. Strick DJ, Elferink LA: Rab15 effector protein: a novel protein for receptor recycling from the endocytic recycling compartment. Mol Biol Cell. 2005 Dec;16(12):5699-709. Epub 2005 Sep 29. [PubMed:16195351 ]