You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08516
Secondary Accession Numbers
  • 14228
Name Ras-related C3 botulinum toxin substrate 3
Synonyms
  1. p21-Rac3
Gene Name RAC3
Protein Type Unknown
Biological Properties
General Function Involved in GTP binding
Specific Function Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as cell spreading and the formation of actin-based protusions including lamellipodia and membrane ruffles
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signal transduction
small gtpase mediated signal transduction
Cellular Location
  1. Cytoplasm
  2. Endomembrane system
  3. Cell projection
  4. lamellipodium
Gene Properties
Chromosome Location Chromosome:1
Locus 17q25.3
SNPs RAC3
Gene Sequence
>579 bp
ATGCAGGCCATCAAGTGCGTGGTGGTCGGCGACGGCGCCGTGGGGAAGACATGCTTGCTG
ATCAGCTACACGACCAACGCCTTCCCCGGAGAGTACATCCCCACCGTTTTTGACAACTAC
TCTGCCAACGTGATGGTGGACGGGAAACCAGTCAACTTGGGGCTGTGGGACACAGCGGGT
CAGGAGGACTACGATCGGCTGCGGCCACTCTCCTACCCCCAAACTGACGTCTTTCTGATC
TGCTTCTCTCTGGTGAGCCCGGCCTCCTTCGAGAATGTTCGTGCCAAGTGGTACCCGGAG
GTGCGGCACCACTGCCCCCACACGCCCATCCTCCTGGTGGGCACCAAGCTGGACCTCCGC
GACGACAAGGACACCATTGAGCGGCTGCGGGACAAGAAGCTGGCACCCATCACCTACCCA
CAGGGCCTGGCCATGGCCCGGGAGATTGGCTCTGTGAAATACCTGGAGTGCTCAGCCCTG
ACCCAGCGGGGCCTGAAGACAGTGTTTGACGAGGCGATCCGCGCGGTGCTCTGCCCGCCC
CCAGTGAAGAAGCCGGGGAAGAAGTGCACCGTCTTCTAG
Protein Properties
Number of Residues 192
Molecular Weight 21378.7
Theoretical pI 8.27
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ras-related C3 botulinum toxin substrate 3
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLR
DDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKPGKKCTVF
GenBank ID Protein 2326206
UniProtKB/Swiss-Prot ID P60763
UniProtKB/Swiss-Prot Entry Name RAC3_HUMAN
PDB IDs
GenBank Gene ID AF008591
GeneCard ID RAC3
GenAtlas ID RAC3
HGNC ID HGNC:9803
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Watabe-Uchida M, John KA, Janas JA, Newey SE, Van Aelst L: The Rac activator DOCK7 regulates neuronal polarity through local phosphorylation of stathmin/Op18. Neuron. 2006 Sep 21;51(6):727-39. [PubMed:16982419 ]
  4. Haataja L, Groffen J, Heisterkamp N: Characterization of RAC3, a novel member of the Rho family. J Biol Chem. 1997 Aug 15;272(33):20384-8. [PubMed:9252344 ]
  5. Haataja L, Groffen J, Heisterkamp N: Identification of a novel Rac3-interacting protein C1D. Int J Mol Med. 1998 Apr;1(4):665-70. [PubMed:9852280 ]
  6. De Langhe S, Haataja L, Senadheera D, Groffen J, Heisterkamp N: Interaction of the small GTPase Rac3 with NRBP, a protein with a kinase-homology domain. Int J Mol Med. 2002 May;9(5):451-9. [PubMed:11956649 ]