You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08521
Secondary Accession Numbers
  • 14233
Name Ras-related protein Rap-2b
Synonyms Not Available
Gene Name RAP2B
Protein Type Unknown
Biological Properties
General Function Involved in GTP binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
intracellular
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
gtpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signal transduction
small gtpase mediated signal transduction
Cellular Location
  1. Cell membrane
  2. Lipid-anchor
  3. Cytoplasmic side (Potential)
Gene Properties
Chromosome Location Chromosome:3
Locus 3q25.2
SNPs RAP2B
Gene Sequence
>552 bp
ATGAGAGAGTACAAAGTGGTGGTGCTGGGCTCGGGCGGCGTGGGCAAGTCCGCGCTCACC
GTGCAGTTCGTGACGGGCTCCTTCATCGAGAAGTACGACCCGACCATCGAAGACTTTTAC
CGCAAGGAGATTGAGGTGGACTCGTCGCCGTCGGTGCTGGAGATCCTGGATACGGCGGGC
ACCGAGCAGTTCGCGTCCATGCGGGACCTGTACATCAAGAACGGCCAGGGCTTCATCCTG
GTCTACAGCCTCGTCAACCAGCAGAGCTTCCAGGACATCAAGCCCATGCGGGACCAGATC
ATCCGCGTGAAGCGGTACGAGCGCGTGCCCATGATCCTGGTGGGCAACAAGGTGGACCTG
GAGGGTGAGCGCGAGGTCTCGTACGGGGAGGGCAAGGCCCTGGCTGAGGAGTGGAGCTGC
CCCTTCATGGAGACGTCGGCCAAAAACAAAGCCTCGGTAGACGAGCTATTTGCCGAGATC
GTGCGGCAGATGAACTACGCGGCGCAGCCCAACGGCGATGAGGGCTGCTGCTCGGCCTGC
GTGATCCTCTGA
Protein Properties
Number of Residues 183
Molecular Weight 20504.2
Theoretical pI 4.44
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ras-related protein Rap-2b
MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAG
TEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDL
EGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSAC
VIL
GenBank ID Protein 20147723
UniProtKB/Swiss-Prot ID P61225
UniProtKB/Swiss-Prot Entry Name RAP2B_HUMAN
PDB IDs
GenBank Gene ID AF493915
GeneCard ID RAP2B
GenAtlas ID RAP2B
HGNC ID HGNC:9862
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Song C, Satoh T, Edamatsu H, Wu D, Tadano M, Gao X, Kataoka T: Differential roles of Ras and Rap1 in growth factor-dependent activation of phospholipase C epsilon. Oncogene. 2002 Nov 21;21(53):8105-13. [PubMed:12444546 ]
  3. Yang H, Sasaki T, Minoshima S, Shimizu N: Identification of three novel proteins (SGSM1, 2, 3) which modulate small G protein (RAP and RAB)-mediated signaling pathway. Genomics. 2007 Aug;90(2):249-60. Epub 2007 May 23. [PubMed:17509819 ]
  4. Farrell FX, Yamamoto K, Lapetina EG: Prenyl group identification of rap2 proteins: a ras superfamily member other than ras that is farnesylated. Biochem J. 1993 Jan 15;289 ( Pt 2):349-55. [PubMed:8424780 ]
  5. Farrell FX, Ohmstede CA, Reep BR, Lapetina EG: cDNA sequence of a new ras-related gene (rap2b) isolated from human platelets with sequence homology to rap2. Nucleic Acids Res. 1990 Jul 25;18(14):4281. [PubMed:2115998 ]
  6. Ohmstede CA, Farrell FX, Reep BR, Clemetson KJ, Lapetina EG: RAP2B: a RAS-related GTP-binding protein from platelets. Proc Natl Acad Sci U S A. 1990 Sep;87(17):6527-31. [PubMed:2118648 ]