Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08530
Secondary Accession Numbers
  • 14242
Name Rab3 GTPase-activating protein non-catalytic subunit
Synonyms
  1. RGAP-iso
  2. Rab3 GTPase-activating protein 150 kDa subunit
  3. Rab3-GAP p150
  4. Rab3-GAP regulatory subunit
  5. Rab3-GAP150
Gene Name RAB3GAP2
Protein Type Unknown
Biological Properties
General Function Involved in GTPase activator activity
Specific Function Regulatory subunit of a GTPase activating protein that has specificity for Rab3 subfamily (RAB3A, RAB3B, RAB3C and RAB3D). Rab3 proteins are involved in regulated exocytosis of neurotransmitters and hormones. Rab3 GTPase-activating complex specifically converts active Rab3-GTP to the inactive form Rab3- GDP. Required for normal eye and brain development. May participate in neurodevelopmental processes such as proliferation, migration and differentiation before synapse formation, and non- synaptic vesicular release of neurotransmitters
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 1q41
SNPs RAB3GAP2
Gene Sequence
>4182 bp
ATGGCCTGCTCCATTGTCCAGTTCTGCTACTTCCAGGACCTCCAGGCCGCCCGGGACTTC
CTCTTTCCTCACCTGCGGGAGGAGATCCTCAGCGGCGCCTTGCGGAGGGACCCCAGTAAA
TCAACAGACTGGGAAGATGATGGTTGGGGAGCATGGGAAGAAAATGAACCACAAGAACCT
GAAGAAGAAGGAAATACTTGCAAAACACAAAAAACTTCCTGGCTCCAAGATTGTGTTTTA
TCCTTATCTCCAACCAATGATCTTATGGTGATAGCTCGAGAGCAAAAAGCTGTATTTCTA
GTGCCAAAATGGAAATATAGTGATAAAGGAAAGGAAGAAATGCAATTTGCTGTTGGCTGG
AGTGGTTCCTTAAATGTCGAAGAAGGGGAATGTGTAACCAGTGCTCTATGTATCCCACTA
GCAAGCCAAAAGAGGAGTTCCACTGGGCGTCCTGACTGGACCTGCATTGTGGTGGGTTTT
ACTTCAGGTTATGTACGCTTCTACACTGAGAATGGTGTGCTCTTGCTTGCACAGCTTTTG
AATGAGGACCCAGTACTTCAACTTAAATGCAGAACCTATGAAATACCACGACATCCCGGC
GTGACTGAGCAGAATGAAGAGTTGAGTATCTTATATCCAGCTGCCATTGTGACTATTGAT
GGATTTAGCCTTTTTCAATCTCTTCGTGCTTGTCGAAATCAGGTAGCAAAAGCTGCAGCA
TCAGGCAACGAGAACATACAACCACCACCATTAGCTTATAAGAAATGGGGTCTACAAGAT
ATTGACACTATTATTGATCATGCTAGTGTTGGTATTATGACTCTGTCCCCCTTTGATCAA
ATGAAGACTGCCTCCAATATAGGTGGATTTAATGCAGCAATTAAAAATAGTCCACCTGCC
ATGTCTCAGTATATCACTGTAGGGTCCAATCCATTTACTGGCTTCTTCTATGCTTTAGAG
GGAAGCACACAACCATTATTATCCCATGTTGCACTAGCAGTTGCAAGTAAACTCACTTCT
GCTTTATTTAATGCTGCCAGTGGTTGGCTTGGTTGGAAAAGTAAGCACGAAGAAGAAGCT
GTCCAAAAGCAAAAGCCGAAGGTTGAGCCAGCTACCCCATTAGCTGTAAGATTTGGACTT
CCAGATTCTAGACGCCATGGTGAAAGCATATGTCTGTCTCCATGTAACACACTGGCAGCA
GTAACAGATGATTTCGGCAGAGTTATTTTATTGGATGTAGCTAGAGGAATTGCAATACGC
ATGTGGAAAGGGTACCGCGACGCACAAATTGGATGGATTCAAACTGTAGAGGACCTCCAT
GAAAGAGTGCCAGAAAAGGCAGATTTTTCCCCCTTTGGAAATTCTCAGGGTCCAAGTCGA
GTAGCTCAATTCCTTGTGATCTATGCGCCAAGAAGGGGAATTTTAGAAGTGTGGAGCACA
CAGCAGGGACCTAGAGTAGGAGCTTTCAATGTGGGGAAGCACTGCAGGCTGCTGTATCCT
GGCTATAAAATAATGGGTTTAAATAATGTTACCAGTCAGAGTTGGCAGCCACAGACTTAT
CAGATCTGTCTGGTTGATCCAGTGTCTGGAAGTGTGAAAACAGTGAACGTTCCCTTCCAT
TTAGCACTGAGTGATAAGAAGAGTGAACGAGCCAAGGATATGCACCTAGTGAAGAAACTA
GCAGCCTTACTGAAAACAAAATCTCCCAATCTTGATTTGGTTGAAACAGAAATAAAGGAA
TTAATTCTTGATATTAAATACCCTGCAACCAAAAAACAAGCTTTGGAAAGCATTTTGGCA
AGTGAACGTTTACCATTTTCTTGCCTTAGAAACATCACTCAGACTTTAATGGACACTTTA
AAAAGTCAAGAACTTGAGTCTGTTGATGAAGGATTGCTACAGTTTTGTGCCAATAAACTA
AAACTGCTGCAACTCTATGAGTCTGTCAGTCAATTAAATTCCCTTGATTTTCATTTAGAC
ACACCATTCTCTGATAATGACTTGGCTCTGTTACTAAGGCTTGATGAAAAAGAACTGCTT
AAGCTCCAGGCATTACTAGAGAAATATAAGCAAGAGAACACCAGGACAAATGTTCGATTT
TCTGATGATAAAGATGGTGTGTTGCCTGTAAAAACATTCTTGGAATATTTAGAATATGAA
AAGGATGTGCTCAACATAAAGAAAATAAGTGAAGAGGAATATGTGGCTTTAGGTAGTTTC
TTTTTTTGGAAGTGTTTGCATGGAGAAAGCTCCACTGAGGATATGTGTCACACTTTGGAG
TCGGCTGGTCTTAGCCCTCAGCTGTTGTTGTCTCTGCTCCTGAGTGTTTGGCTTTCAAAG
GAAAAGGATATTTTGGATAAACCACAGTCAATCTGCTGTCTTCATACCATGCTGTCCCTC
CTGAGCAAGATGAAAGTGGCCATCGATGAGACCTGGGATTCTCAGTCTGTGTCCCCATGG
TGGCAGCAGATGCGCACAGCCTGTATTCAGTCTGAGAACAATGGAGCCGCTCTGTTGTCT
GCGCATGTTGGGCATTCTGTTGCTGCACAGATATCAAACAACATGACAGAGAAAAAATTT
TCCCAAACAGTTTTGGGTGCTGATTCAGAGGCCCTCACTGATTCCTGGGAGGCACTTTCT
CTTGACACTGAGTACTGGAAACTCCTTCTGAAACAGCTGGAGGATTGTCTCATACTTCAG
ACTCTGCTTCACAGCAAAGGGAACACTCAGACCTCCAAAGTGTCATCACTGCAGGCTGAG
CCACTTCCAAGGCTTTCTGTTAAAAAGTTATTAGAAGGAGGAAAAGGTGGCATTGCAGAC
AGTGTAGCCAAGTGGATATTTAAACAGGACTTCAGCCCTGAAGTATTAAAACTGGCTAAT
GAAGAAAGAGATGCAGAAAACCCAGATGAACCCAAAGAAGGTGTTAACAGAAGTTTCCTT
GAGGTATCAGAGATGGAGATGGACTTAGGAGCCATACCAGACTTACTGCATTTAGCCTAT
GAGCAGTTTCCTTGTAGCCTTGAGCTCGATGTCTTGCATGCACATTGCTGCTGGGAGTAC
GTTGTTCAGTGGAATAAAGATCCAGAGGAAGCACGTTTTTTTGTTAGGTCAATAGAACAC
TTGAAGCAAATATTTAATGCACATGTTCAAAATGGCATTGCACTGATGATGTGGAATACG
TTCTTAGTTAAAAGATTTTCTGCTGCTACATACTTAATGGATAAGGTTGGAAAATCACCA
AAAGATAGGTTATGCCGAAGGGATGTGGGAATGAGTGACACAGCAATGACATCTTTCCTC
GGCTCCTGTTTGGATCTTCTTCAGATCTTAATGGAGGCAGATGTTAGCAGGGATGAAATA
CAGGTGCCTGTGCTGGATACTGAGGATGCGTGGCTCTCCGTGGAAGGACCAATCTCCATA
GTGGAACTGGCCCTTGAACAGAAGCACATCCACTACCCACTGGTGGAGCACCACTCCATC
CTGTGCTCCATCTTGTATGCAGTCATGAGGTTTTCTCTGAAGACCGTGAAGCCACTTTCA
CTTTTTGACAGTAAGGGAAAAAATGCATTTTTCAAAGACCTAACTTCAATTCAGTTATTA
CCTAGTGGGGAAATGGATCCAAATTTTATTTCTGTACGACAACAGTTCTTATTGAAAGTT
GTCAGTGCAGCTGTCCAGGCCCAACATTCAGCCACAAAGGTCAAAGATCCCACAGAAGAG
GCCACACCCACTCCTTTTGGGAAAGACCAAGATTGGCCAGCTCTAGCTGTGGATTTAGCC
CATCACCTTCAAGTTAGTGAAGATGTTGTTAGAAGGCATTATGTGGGGGAACTATACAAC
TATGGAGTTGACCACTTAGGAGAAGAGGCCATTCTACAGGTTCATGACAAAGAGGTCCTT
GCCTCTCAGCTGCTGGTGCTCACGGGGCAAAGGCTGGCTCATGCGCTTCTCCACACCCAG
ACAAAAGAAGGAATGGAGCTGCTTGCCAGACTTCCACCCACACTGTGTACTTGGCTGAAA
GCAATGGACCCCCAGGACCTTCAAAACACTGAAGTGCCAATTGCAACAACAGCTAAACTA
GTAAATAAAGTAATTGAGCTTTTACCAGAAAAACATGGGCAATATGGTCTAGCCTTACAC
CTCATTGAAGCTGTGGAAGCCATATCTCTTCCTTCTTTATGA
Protein Properties
Number of Residues 1393
Molecular Weight 155983.3
Theoretical pI 5.34
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rab3 GTPase-activating protein non-catalytic subunit
MACSIVQFCYFQDLQAARDFLFPHLREEILSGALRRDPSKSTDWEDDGWGAWEENEPQEP
EEEGNTCKTQKTSWLQDCVLSLSPTNDLMVIAREQKAVFLVPKWKYSDKGKEEMQFAVGW
SGSLNVEEGECVTSALCIPLASQKRSSTGRPDWTCIVVGFTSGYVRFYTENGVLLLAQLL
NEDPVLQLKCRTYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQSLRACRNQVAKAAA
SGNENIQPPPLAYKKWGLQDIDTIIDHASVGIMTLSPFDQMKTASNIGGFNAAIKNSPPA
MSQYITVGSNPFTGFFYALEGSTQPLLSHVALAVASKLTSALFNAASGWLGWKSKHEEEA
VQKQKPKVEPATPLAVRFGLPDSRRHGESICLSPCNTLAAVTDDFGRVILLDVARGIAIR
MWKGYRDAQIGWIQTVEDLHERVPEKADFSPFGNSQGPSRVAQFLVIYAPRRGILEVWST
QQGPRVGAFNVGKHCRLLYPGYKIMGLNNVTSQSWQPQTYQICLVDPVSGSVKTVNVPFH
LALSDKKSERAKDMHLVKKLAALLKTKSPNLDLVETEIKELILDIKYPATKKQALESILA
SERLPFSCLRNITQTLMDTLKSQELESVDEGLLQFCANKLKLLQLYESVSQLNSLDFHLD
TPFSDNDLALLLRLDEKELLKLQALLEKYKQENTRTNVRFSDDKDGVLPVKTFLEYLEYE
KDVLNIKKISEEEYVALGSFFFWKCLHGESSTEDMCHTLESAGLSPQLLLSLLLSVWLSK
EKDILDKPQSICCLHTMLSLLSKMKVAIDETWDSQSVSPWWQQMRTACIQSENNGAALLS
AHVGHSVAAQISNNMTEKKFSQTVLGADSEALTDSWEALSLDTEYWKLLLKQLEDCLILQ
TLLHSKGNTQTSKVSSLQAEPLPRLSVKKLLEGGKGGIADSVAKWIFKQDFSPEVLKLAN
EERDAENPDEPKEGVNRSFLEVSEMEMDLGAIPDLLHLAYEQFPCSLELDVLHAHCCWEY
VVQWNKDPEEARFFVRSIEHLKQIFNAHVQNGIALMMWNTFLVKRFSAATYLMDKVGKSP
KDRLCRRDVGMSDTAMTSFLGSCLDLLQILMEADVSRDEIQVPVLDTEDAWLSVEGPISI
VELALEQKHIHYPLVEHHSILCSILYAVMRFSLKTVKPLSLFDSKGKNAFFKDLTSIQLL
PSGEMDPNFISVRQQFLLKVVSAAVQAQHSATKVKDPTEEATPTPFGKDQDWPALAVDLA
HHLQVSEDVVRRHYVGELYNYGVDHLGEEAILQVHDKEVLASQLLVLTGQRLAHALLHTQ
TKEGMELLARLPPTLCTWLKAMDPQDLQNTEVPIATTAKLVNKVIELLPEKHGQYGLALH
LIEAVEAISLPSL
GenBank ID Protein 20521672
UniProtKB/Swiss-Prot ID Q9H2M9
UniProtKB/Swiss-Prot Entry Name RBGPR_HUMAN
PDB IDs Not Available
GenBank Gene ID AB020646
GeneCard ID RAB3GAP2
GenAtlas ID RAB3GAP2
HGNC ID HGNC:17168
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  5. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  6. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  7. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Dec 31;5(6):355-64. [PubMed:10048485 ]
  8. Nagano F, Sasaki T, Fukui K, Asakura T, Imazumi K, Takai Y: Molecular cloning and characterization of the noncatalytic subunit of the Rab3 subfamily-specific GTPase-activating protein. J Biol Chem. 1998 Sep 18;273(38):24781-5. [PubMed:9733780 ]
  9. Aligianis IA, Morgan NV, Mione M, Johnson CA, Rosser E, Hennekam RC, Adams G, Trembath RC, Pilz DT, Stoodley N, Moore AT, Wilson S, Maher ER: Mutation in Rab3 GTPase-activating protein (RAB3GAP) noncatalytic subunit in a kindred with Martsolf syndrome. Am J Hum Genet. 2006 Apr;78(4):702-7. Epub 2006 Feb 14. [PubMed:16532399 ]