You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08534
Secondary Accession Numbers
  • 14246
Name E3 SUMO-protein ligase RanBP2
Synonyms
  1. 358 kDa nucleoporin
  2. Nuclear pore complex protein Nup358
  3. Nucleoporin Nup358
  4. Ran-binding protein 2
  5. RanBP2
  6. p270
Gene Name RANBP2
Protein Type Unknown
Biological Properties
General Function Involved in peptidyl-prolyl cis-trans isomerase activity
Specific Function E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I. Involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates. Could also have isomerase or chaperone activity and may bind RNA or DNA. Component of the nuclear export pathway. Specific docking site for the nuclear export factor exportin-1
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
zinc ion binding
cis-trans isomerase activity
peptidyl-prolyl cis-trans isomerase activity
isomerase activity
Process
metabolic process
macromolecule metabolic process
establishment of localization
transport
cellular protein metabolic process
protein folding
intracellular transport
protein metabolic process
Cellular Location
  1. Nucleus
  2. nuclear pore complex
Gene Properties
Chromosome Location Chromosome:2
Locus 2q12.3
SNPs RANBP2
Gene Sequence
>9675 bp
ATGAGGCGCAGCAAGGCTGACGTGGAGCGGTACATCGCCTCGGTGCAGGGCTCCACCCCG
TCGCCTCGACAGAAGTCAATGAAAGGATTCTATTTTGCAAAGCTGTATTATGAAGCTAAA
GAATATGATCTTGCTAAAAAATACATATGTACTTACATTAATGTGCAAGAGAGGGATCCC
AAAGCTCACAGATTTCTGGGTCTTCTTTATGAATTGGAAGAAAACACAGACAAAGCCGTT
GAATGTTACAGGCGTTCAGTGGAATTAAACCCAACACAAAAAGATCTTGTGTTGAAGATT
GCAGAATTGCTTTGTAAAAATGATGTTACTGATGGAAGAGCAAAATACTGGCTTGAAAGA
GCAGCCAAACTTTTCCCAGGAAGTCCTGCAATTTATAAACTAAAGGAACAGCTTCTAGAT
TGTGAAGGTGAAGATGGATGGAATAAACTTTTTGACTTGATTCAGTCAGAACTTTATGTA
AGACCTGATGACGTCCATGTGAACATCCGGCTAGTGGAGGTGTATCGCTCAACTAAAAGA
TTGAAGGATGCTGTGGCCCACTGCCATGAGGCAGAGAGGAACATAGCTTTGCGTTCAAGT
TTAGAATGGAATTCGTGTGTTGTACAGACCCTTAAGGAATATCTGGAGTCTTTACAGTGT
TTGGAGTCTGATAAAAGTGACTGGCGAGCAACCAATACAGACTTACTGCTGGCCTATGCT
AATCTTATGCTTCTTACGCTTTCCACTAGAGATGTGCAGGAAAGTAGAGAATTACTGCAA
AGTTTTGATAGTGCTCTTCAGTCTGTGAAATCTTTGGGTGGAAATGATGAACTGTCAGCT
ACTTTCTTAGAAATGAAAGGACATTTCTACATGCATGCTGGTTCTCTGCTTTTGAAGATG
GGTCAGCATAGTAGTAATGTTCAATGGCGAGCTCTTTCTGAGCTGGCTGCATTGTGCTAT
CTCATAGCATTTCAGGTTCCAAGACCAAAGATTAAATTAATAAAAGGTGAAGCTGGACAA
AATCTGCTGGAAATGATGGCCTGTGACCGACTGAGCCAATCAGGGCACATGTTGCTAAAC
TTAAGTCGTGGCAAGCAAGATTTTTTAAAAGAGATTGTTGAAACTTTTGCCAACAAAAGC
GGGCAGTCTGCATTATATGATGCTCTGTTTTCTAGTCAGTCACCTAAGGATACATCTTTT
CTTGGTAGCGATGATATTGGAAACATTGATGTACGAGAACCAGAGCTTGAAGATTTGACT
AGATACGATGTTGGTGCTATTCGAGCACATAATGGTAGTCTTCAGCACCTTACTTGGCTT
GGCTTACAGTGGAATTCATTGCCTGCTTTACCTGGAATCCGAAAATGGCTAAAACAGCTT
TTCCATCATTTGCCCCATGAAACCTCAAGGCTTGAAACAAATGCACCTGAATCAATATGT
ATTTTAGATCTTGAAGTATTTCTCCTTGGAGTAGTATATACCAGCCACTTACAATTAAAG
GAGAAATGTAATTCTCACCACAGCTCCTATCAGCCGTTATGCCTGCCCCTTCCTGTGTGT
AAACAGCTTTGTACAGAAAGACAAAAATCTTGGTGGGATGCGGTTTGTACTCTGATTCAC
AGAAAAGCAGTACCTGGAAACGTAGCAAAATTGAGACTTCTAGTTCAGCATGAAATAAAC
ACTCTAAGAGCCCAGGAAAAACATGGCCTTCAACCTGCTCTGCTTGTACATTGGGCAGAA
TGCCTTCAGAAAACGGGCAGCGGTCTTAATTCTTTTTATGATCAACGAGAATACATAGGG
AGAAGTGTTCATTATTGGAAGAAAGTTTTGCCATTGTTGAAGATAATAAAAAAGAAGAAC
AGTATTCCTGAACCTATTGATCCTCTGTTTAAACATTTTCATAGTGTAGACATTCAGGCA
TCAGAAATTGTTGAATATGAAGAAGACGCACACATAACTTTTGCTATATTGGATGCAGTA
AATGGAAATATAGAAGATGCTGTGACTGCTTTTGAATCTATAAAAAGTGTTGTTTCTTAT
TGGAATCTTGCACTGATTTTTCACAGGAAGGCAGAAGACATTGAAAATGATGCCCTTTCT
CCTGAAGAACAAGAAGAATGCAAAAATTATCTGAGAAAGACCAGGGACTACCTAATAAAG
ATTATAGATGACAGTGATTCAAATCTTTCAGTGGTCAAGAAATTGCCTGTGCCCCTGGAG
TCTGTAAAAGAGATGCTTAATTCAGTCATGCAGGAACTCGAAGACTATAGTGAAGGAGGT
CCTCTCTATAAAAATGGTTCTTTGCGAAATGCAGATTCAGAAATAAAACATTCTACACCG
TCTCCTACCAGATATTCACTATCACCAAGTAAAAGTTACAAGTATTCTCCCAAAACACCA
CCTCGATGGGCAGAAGATCAGAATTCTTTACTGAAAATGATTTGCCAACAAGTAGAGGCC
ATTAAGAAAGAAATGCAGGAGTTGAAACTAAATAGCAGTAACTCAGCATCCCCTCATCGT
TGGCCCACAGAGAATTATGGACCAGACTCAGTGCCTGATGGATATCAGGGGTCACAGACA
TTTCATGGGGCTCCACTAACAGTTGCAACTACTGGCCCTTCAGTATATTATAGTCAGTCA
CCAGCATATAATTCCCAGTATCTTCTCAGACCAGCAGCTAATGTTACTCCCACAAAGGGC
CCAGTCTATGGCATGAATAGGCTTCCACCCCAACAGCATATTTATGCCTATCCGCAACAG
ATGCACACACCGCCAGTGCAAAGCTCATCTGCTTGTATGTTCTCTCAGGAGATGTATGGT
CCTCCTGCATTGCGTTTTGAGTCTCCTGCAACGGGAATTCTATCGCCCAGGGGTGATGAT
TACTTTAATTACAATGTTCAACAGACAAGCACAAATCCACCTTTGCCAGAACCAGGATAT
TTCACAAAACCTCCGATTGCAGCTCATGCTTCAAGATCTGCAGAATCTAAGACTATAGAA
TTTGGGAAAACTAATTTTGTTCAGCCCATGCCGGGTGAAGGATTAAGGCCATCTTTGCCA
ACACAAGCACACACAACACAGCCAACTCCTTTTAAATTTAACTCAAATTTCAAATCAAAT
GATGGTGACTTCACGTTTTCCTCACCACAGGTTGTGACACAGCCCCCTCCTGCAGCTTAC
AGTAACAGTGAAAGCCTTTTAGGTCTCCTGACTTCAGATAAACCCTTGCAAGGAGATGGC
TATAGTGGAGCCAAACCAATTCCTGGTGGTCAAACCATTGGGCCTCGAAATACATTCAAT
TTTGGAAGCAAAAATGTGTCTGGAATTTCATTTACAGAAAACATGGGGTCGAGTCAGCAA
AAGAATTCTGGTTTTCGGCGAAGTGATGATATGTTTACTTTCCATGGTCCAGGGAAATCA
GTATTTGGAACACCCACTTTAGAGACAGCAAACAAGAATCATGAGACAGATGGAGGAAGT
GCCCATGGGGATGATGATGATGACGGTCCTCACTTTGAGCCTGTAGTACCTCTTCCTGAT
AAGATTGAAGTAAAAACTGGTGAGGAAGATGAAGAAGAATTCTTTTGCAACCGCGCGAAA
TTGTTTCGTTTCGATGTAGAATCCAAAGAATGGAAAGAACGTGGGATTGGCAATGTAAAA
ATACTGAGGCATAAAACATCTGGTAAAATTCGCCTTCTAATGAGACGAGAGCAAGTATTG
AAAATCTGTGCAAATCATTACATCAGTCCAGATATGAAATTGACACCAAATGCTGGATCA
GACAGATCTTTTGTATGGCATGCCCTTGATTATGCAGATGAGTTGCCAAAACCAGAACAA
CTTGCTATTAGGTTCAAAACTCCTGAGGAAGCAGCACTTTTTAAATGCAAGTTTGAAGAA
GCCCAGAGCATTTTAAAAGCCCCAGGAACAAATGTAGCCATGGCGTCAAATCAGGCTGTC
AGAATTGTAAAAGAACCCACAAGTCATGATAACAAGGATATTTGCAAATCTGATGCTGGA
AACCTGAATTTTGAATTTCAGGTTGCAAAGAAAGAAGGGTCTTGGTGGCATTGTAACAGC
TGCTCATTAAAGAATGCTTCAACTGCTAAGAAATGTGTATCATGCCAAAATCTAAACCCA
AGCAATAAAGAGCTCGTTGGCCCACCATTAGCTGAAACTGTTTTTACTCCTAAAACCAGC
CCAGAGAATGTTCAAGATCGATTTGCATTGGTGACTCCAAAGAAAGAAGGTCACTGGGAT
TGTAGTATTTGTTTAGTAAGAAATGAACCTACTGTATCTAGGTGCATTGCGTGTCAGAAT
ACAAAATCTGCTAACAAAAGTGGATCTTCATTTGTTCATCAAGCTTCATTTAAATTTGGC
CAGGGAGATCTTCCTAAACCTATTAACAGTGATTTCAGATCTGTTTTTTCTACAAAGGAA
GGACAGTGGGATTGCAGTGCATGTTTGGTACAAAATGAGGGGAGCTCTACAAAATGTGCT
GCTTGTCAGAATCCGAGAAAACAGAGTCTACCTGCTACTTCTATTCCAACACCTGCCTCT
TTTAAGTTTGGTACTTCAGAGACAAGTAAAACTCTAAAAAGTGGATTTGAAGACATGTTT
GCTAAGAAGGAAGGACAGTGGGATTGCAGTTCATGCTTAGTGCGAAATGAAGCAAATGCT
ACAAGATGTGTTGCTTGTCAGAATCCGGATAAACCAAGTCCATCTACTTCTGTTCCAGCT
CCTGCCTCTTTTAAGTTTGGTACTTCAGAGACAAGCAAGGCTCCAAAGAGCGGATTTGAG
GGAATGTTCACTAAGAAGGAGGGACAGTGGGATTGCAGTGTGTGCTTAGTAAGAAATGAA
GCCAGTGCTACCAAATGTATTGCTTGTCAGAATCCAGGTAAACAAAATCAAACTACTTCT
GCAGTTTCAACACCTGCCTCTTCAGAGACAAGCAAGGCTCCAAAGAGCGGATTTGAGGGA
ATGTTCACTAAGAAGGAGGGACAGTGGGATTGCAGTGTGTGCTTAGTAAGAAATGAAGCC
AGTGCTACCAAATGTATTGCTTGTCAGAATCCAGGTAAACAAAATCAAACTACTTCTGCA
GTTTCAACACCTGCCTCTTCAGAGACAAGCAAGGCTCCAAAGAGCGGATTTGAGGGAATG
TTCACTAAGAAGGAAGGACAGTGGGATTGCAGTGTGTGCTTAGTAAGAAATGAAGCCAGT
GCTACCAAATGTATTGCTTGTCAGTGTCCAAGTAAACAAAATCAAACAACTGCAATTTCA
ACACCTGCCTCTTCGGAGATAAGCAAGGCTCCAAAGAGTGGATTTGAAGGAATGTTCATC
AGGAAAGGACAGTGGGATTGTAGTGTTTGCTGTGTACAAAATGAGAGTTCTTCCTTAAAA
TGTGTGGCTTGTGATGCCTCTAAACCAACTCATAAACCTATTGCAGAAGCTCCTTCAGCT
TTCACACTGGGCTCAGAAATGAAGTTGCATGACTCTTCTGGAAGTCAGGTGGGAACAGGA
TTTAAAAGTAATTTCTCAGAAAAAGCTTCTAAGTTTGGCAATACAGAGCAAGGATTCAAA
TTTGGGCATGTGGATCAAGAAAATTCACCTTCATTTATGTTTCAGGGTTCTTCTAATACA
GAATTTAAGTCAACCAAAGAAGGATTTTCCATCCCTGTGTCTGCTGATGGATTTAAATTT
GGCATTTCGGAACCAGGAAATCAAGAAAAGAAAAGTGAAAAGCCTCTTGAAAATGGTACT
GGCTTCCAGGCTCAGGATATTAGTGGCCAGAAGAATGGCCGTGGTGTGATTTTTGGCCAA
ACAAGTAGCACTTTTACATTTGCAGATCTTGCAAAATCAACTTCAGGAGAAGGATTTCAG
TTTGGCAAAAAAGACCCCAATTTCAAGGGATTTTCAGGTGCTGGAGAAAAATTATTCTCA
TCACAATACGGTAAAATGGCCAATAAAGCAAACACTTCCGGTGACTTTGAGAAAGATGAT
GATGCCTATAAGACTGAGGACAGCGATGACATCCATTTTGAACCAGTAGTTCAAATGCCC
GAAAAAGTAGAACTTGTAACAGGAGAAGAAGATGAAAAAGTTCTGTATTCACAGCGGGTA
AAACTATTTAGATTTGATGCTGAGGTAAGTCAGTGGAAAGAAAGGGGCTTGGGGAACTTA
AAAATTCTCAAAAACGAGGTCAATGGCAAACTAAGAATGCTGATGCGAAGAGAACAAGTA
CTAAAAGTGTGTGCTAATCATTGGATAACGACTACGATGAACCTGAAGCCTCTCTCTGGA
TCAGATAGAGCATGGATGTGGTTAGCCAGTGATTTCTCTGATGGTGATGCCAAACTAGAG
CAGTTGGCAGCAAAATTTAAAACACCAGAGCTGGCTGAAGAATTCAAGCAGAAATTTGAG
GAATGCCAGCGGCTTCTGTTAGACATACCACTTCAAACTCCCCATAAACTTGTAGATACT
GGCAGAGCTGCCAAGTTAATACAGAGAGCTGAAGAAATGAAGAGTGGACTGAAAGATTTC
AAAACATTTTTGACAAATGATCAAACAAAAGTCACTGAGGAAGAAAATAAGGGTTCAGGT
ACAGGTGCGGCCGGTGCCTCAGACACAACAATAAAACCCAATCCTGAAAACACTGGGCCC
ACATTAGAATGGGATAACTATGATTTAAGGGAAGATGCTTTGGATGATAGTGTCAGTAGT
AGCTCAGTACATGCTTCTCCATTGGCAAGTAGCCCTGTGAGAAAAAATCTTTTCCGTTTT
GGTGAGTCAACAACAGGATTTAACTTCAGTTTTAAATCTGCTTTGAGTCCATCTAAGTCT
CCTGCCAAGTTGAATCAGAGTGGGACTTCAGTTGGCACTGATGAAGAATCTGATGTTACT
CAAGAAGAAGAGAGAGATGGACAGTACTTTGAACCTGTTGTTCCTTTACCTGATCTAGTT
GAAGTATCCAGTGGTGAGGAAAATGAACAAGTTGTTTTTAGTCACAGGGCAAAACTCTAC
AGATATGATAAAGATGTTGGTCAATGGAAAGAAAGGGGCATTGGTGATATAAAGATTTTA
CAGAATTATGATAATAAGCAAGTTCGTATAGTGATGAGAAGGGACCAAGTATTAAAACTT
TGTGCCAATCACAGAATAACTCCAGACATGACTTTGCAAAATATGAAAGGGACAGAAAGA
GTATGGTTGTGGACTGCATGTGATTTTGCAGATGGAGAAAGAAAAGTAGAGCATTTAGCT
GTTCGTTTTAAACTACAGGATGTTGCAGACTCGTTTAAGAAAATTTTTGATGAAGCAAAA
ACAGCCCAGGAAAAAGATTCTTTGATAACACCTCATGTTTCTCGGTCAAGCACTCCCAGA
GAGTCACCATGTGGCAAAATTGCTGTAGCTGTATTAGAAGAAACCACAAGAGAGAGGACA
GATGTTATTCAGGGTGATGATGTAGCAGATGCAACTTCAGAAGTTGAAGTGTCTAGCACA
TCTGAAACAACACCAAAAGCAGTGGTTTCTCCTCCAAAGTTTGTATTTGGTTCAGAGTCT
GTTAAAAGCATTTTTAGTAGTGAAAAATCAAAACCATTTGCATTCGGCAACAGTTCAGCC
ACTGGGTCTTTGTTTGGATTTAGTTTTAATGCACCTTTGAAAAGTAACAATAGTGAAACT
AGTTCAGTAGCCCAGAGTGGATCTGAAAGCAAAGTGGAACCTAAAAAATGTGAACTGTCA
AAGAACTCTGATATCGAACAGTCTTCAGATAGCAAAGTCAAAAATCTCTTTGCTTCCTTT
CCAACGGAAGAATCTTCAATCAACTACACATTTAAAACACCAGAAAAGGCAAAAGAGAAG
AAAAAACCTGAAGATTCTCCCTCAGATGATGATGTTCTCATTGTATATGAACTAACTCCA
ACCGCTGAGCAGAAAGCCCTTGCAACCAAACTTAAACTTCCTCCAACTTTCTTCTGCTAC
AAGAATAGACCAGATTATGTTAGTGAAGAAGAGGAGGATGATGAAGATTTCGAAACAGCT
GTCAAGAAACTTAATGGAAAACTATATTTGGATGGCTCAGAAAAATGTAGACCCTTGGAA
GAAAATACAGCAGATAATGAGAAAGAATGTATTATTGTTTGGGAAAAGAAACCAACAGTT
GAAGAGAAGGCAAAAGCAGATACGTTAAAACTTCCACCTACATTTTTTTGTGGAGTCTGT
AGTGATACTGATGAAGACAATGGAAATGGGGAAGACTTTCAATCAGAGCTTCAAAAAGTT
CAGGAAGCTCAAAAATCTCAGACAGAAGAAATAACTAGCACAACTGACAGTGTATATACA
GGTGGGACTGAAGTGATGGTACCTTCTTTCTGTAAATCTGAAGAACCTGATTCTATTACC
AAATCCATTAGTTCACCATCTGTTTCCTCTGAAACTATGGACAAACCTGTAGATTTGTCA
ACTAGAAAGGAAATTGATACAGATTCTACAAGCCAAGGGGAAAGCAAGATAGTTTCATTT
GGATTTGGAAGTAGCACAGGGCTCTCATTTGCAGACTTGGCTTCCAGTAATTCTGGAGAT
TTTGCTTTTGGTTCTAAAGATAAAAATTTCCAATGGGCAAATACTGGAGCAGCTGTGTTT
GGAACACAGTCAGTCGGAACCCAGTCAGCCGGTAAAGTTGGTGAAGATGAAGATGGTAGT
GATGAAGAAGTAGTTCATAATGAAGATATCCATTTTGAACCAATAGTGTCACTACCAGAG
GTAGAAGTAAAATCTGGAGAAGAAGATGAAGAAATTTTGTTTAAAGAGAGAGCCAAACTT
TATAGATGGGATCGGGATGTCAGTCAGTGGAAGGAGCGCGGTGTTGGAGATATAAAGATT
CTTTGGCATACAATGAAGAATTATTACCGGATCCTAATGAGAAGAGACCAGGTTTTTAAA
GTGTGTGCAAACCACGTTATTACTAAAACAATGGAATTAAAGCCCTTAAATGTTTCAAAT
AATGCTTTAGTTTGGACTGCCTCAGATTATGCTGATGGAGAAGCAAAAGTAGAACAGCTT
GCAGTGAGATTTAAAACTAAAGAAGTAGCTGATTGTTTCAAGAAAACATTTGAAGAATGT
CAGCAGAATTTAATGAAACTCCAGAAAGGACATGTATCACTGGCAGCAGAATTATCAAAG
GAGACCAATCCTGTGGTGTTTTTTGATGTTTGTGCGGACGGTGAACCTCTAGGGCGGATA
ACTATGGAATTATTTTCAAACATTGTTCCTCGGACTGCTGAGAACTTCAGAGCACTATGC
ACTGGAGAGAAAGGCTTTGGTTTCAAGAATTCCATTTTTCACAGAGTAATTCCAGATTTT
GTTTGCCAAGGAGGAGATATCACCAAACATGATGGAACAGGCGGACAGTCCATTTATGGA
GACAAATTTGAAGATGAAAATTTTGATGTGAAACATACTGGTCCTGGTTTACTATCCATG
GCCAATCAAGGCCAGAATACCAATAATTCTCAATTTGTTATAACACTGAAGAAAGCAGAA
CATTTGGACTTTAAGCATGTAGTATTTGGGTTTGTTAAGGATGGCATGGATACTGTGAAA
AAGATTGAATCATTTGGTTCTCCCAAAGGGTCTGTTTGTCGAAGAATAACTATCACAGAA
TGTGGACAGATATAA
Protein Properties
Number of Residues 3224
Molecular Weight 358196.4
Theoretical pI 6.1
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>E3 SUMO-protein ligase RanBP2
MRRSKADVERYIASVQGSTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDP
KAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWLER
AAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVEVYRSTKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKEYLESLQCLESDKSDWRATNTDLLLAYA
NLMLLTLSTRDVQESRELLQSFDSALQSVKSLGGNDELSATFLEMKGHFYMHAGSLLLKM
GQHSSNVQWRALSELAALCYLIAFQVPRPKIKLIKGEAGQNLLEMMACDRLSQSGHMLLN
LSRGKQDFLKEIVETFANKSGQSALYDALFSSQSPKDTSFLGSDDIGNIDVREPELEDLT
RYDVGAIRAHNGSLQHLTWLGLQWNSLPALPGIRKWLKQLFHHLPHETSRLETNAPESIC
ILDLEVFLLGVVYTSHLQLKEKCNSHHSSYQPLCLPLPVCKQLCTERQKSWWDAVCTLIH
RKAVPGNVAKLRLLVQHEINTLRAQEKHGLQPALLVHWAECLQKTGSGLNSFYDQREYIG
RSVHYWKKVLPLLKIIKKKNSIPEPIDPLFKHFHSVDIQASEIVEYEEDAHITFAILDAV
NGNIEDAVTAFESIKSVVSYWNLALIFHRKAEDIENDALSPEEQEECKNYLRKTRDYLIK
IIDDSDSNLSVVKKLPVPLESVKEMLNSVMQELEDYSEGGPLYKNGSLRNADSEIKHSTP
SPTRYSLSPSKSYKYSPKTPPRWAEDQNSLLKMICQQVEAIKKEMQELKLNSSNSASPHR
WPTENYGPDSVPDGYQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTKG
PVYGMNRLPPQQHIYAYPQQMHTPPVQSSSACMFSQEMYGPPALRFESPATGILSPRGDD
YFNYNVQQTSTNPPLPEPGYFTKPPIAAHASRSAESKTIEFGKTNFVQPMPGEGLRPSLP
TQAHTTQPTPFKFNSNFKSNDGDFTFSSPQVVTQPPPAAYSNSESLLGLLTSDKPLQGDG
YSGAKPIPGGQTIGPRNTFNFGSKNVSGISFTENMGSSQQKNSGFRRSDDMFTFHGPGKS
VFGTPTLETANKNHETDGGSAHGDDDDDGPHFEPVVPLPDKIEVKTGEEDEEEFFCNRAK
LFRFDVESKEWKERGIGNVKILRHKTSGKIRLLMRREQVLKICANHYISPDMKLTPNAGS
DRSFVWHALDYADELPKPEQLAIRFKTPEEAALFKCKFEEAQSILKAPGTNVAMASNQAV
RIVKEPTSHDNKDICKSDAGNLNFEFQVAKKEGSWWHCNSCSLKNASTAKKCVSCQNLNP
SNKELVGPPLAETVFTPKTSPENVQDRFALVTPKKEGHWDCSICLVRNEPTVSRCIACQN
TKSANKSGSSFVHQASFKFGQGDLPKPINSDFRSVFSTKEGQWDCSACLVQNEGSSTKCA
ACQNPRKQSLPATSIPTPASFKFGTSETSKTLKSGFEDMFAKKEGQWDCSSCLVRNEANA
TRCVACQNPDKPSPSTSVPAPASFKFGTSETSKAPKSGFEGMFTKKEGQWDCSVCLVRNE
ASATKCIACQNPGKQNQTTSAVSTPASSETSKAPKSGFEGMFTKKEGQWDCSVCLVRNEA
SATKCIACQNPGKQNQTTSAVSTPASSETSKAPKSGFEGMFTKKEGQWDCSVCLVRNEAS
ATKCIACQCPSKQNQTTAISTPASSEISKAPKSGFEGMFIRKGQWDCSVCCVQNESSSLK
CVACDASKPTHKPIAEAPSAFTLGSEMKLHDSSGSQVGTGFKSNFSEKASKFGNTEQGFK
FGHVDQENSPSFMFQGSSNTEFKSTKEGFSIPVSADGFKFGISEPGNQEKKSEKPLENGT
GFQAQDISGQKNGRGVIFGQTSSTFTFADLAKSTSGEGFQFGKKDPNFKGFSGAGEKLFS
SQYGKMANKANTSGDFEKDDDAYKTEDSDDIHFEPVVQMPEKVELVTGEEDEKVLYSQRV
KLFRFDAEVSQWKERGLGNLKILKNEVNGKLRMLMRREQVLKVCANHWITTTMNLKPLSG
SDRAWMWLASDFSDGDAKLEQLAAKFKTPELAEEFKQKFEECQRLLLDIPLQTPHKLVDT
GRAAKLIQRAEEMKSGLKDFKTFLTNDQTKVTEEENKGSGTGAAGASDTTIKPNPENTGP
TLEWDNYDLREDALDDSVSSSSVHASPLASSPVRKNLFRFGESTTGFNFSFKSALSPSKS
PAKLNQSGTSVGTDEESDVTQEEERDGQYFEPVVPLPDLVEVSSGEENEQVVFSHRAKLY
RYDKDVGQWKERGIGDIKILQNYDNKQVRIVMRRDQVLKLCANHRITPDMTLQNMKGTER
VWLWTACDFADGERKVEHLAVRFKLQDVADSFKKIFDEAKTAQEKDSLITPHVSRSSTPR
ESPCGKIAVAVLEETTRERTDVIQGDDVADATSEVEVSSTSETTPKAVVSPPKFVFGSES
VKSIFSSEKSKPFAFGNSSATGSLFGFSFNAPLKSNNSETSSVAQSGSESKVEPKKCELS
KNSDIEQSSDSKVKNLFASFPTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTP
TAEQKALATKLKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLE
ENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKV
QEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKSISSPSVSSETMDKPVDLS
TRKEIDTDSTSQGESKIVSFGFGSSTGLSFADLASSNSGDFAFGSKDKNFQWANTGAAVF
GTQSVGTQSAGKVGEDEDGSDEEVVHNEDIHFEPIVSLPEVEVKSGEEDEEILFKERAKL
YRWDRDVSQWKERGVGDIKILWHTMKNYYRILMRRDQVFKVCANHVITKTMELKPLNVSN
NALVWTASDYADGEAKVEQLAVRFKTKEVADCFKKTFEECQQNLMKLQKGHVSLAAELSK
ETNPVVFFDVCADGEPLGRITMELFSNIVPRTAENFRALCTGEKGFGFKNSIFHRVIPDF
VCQGGDITKHDGTGGQSIYGDKFEDENFDVKHTGPGLLSMANQGQNTNNSQFVITLKKAE
HLDFKHVVFGFVKDGMDTVKKIESFGSPKGSVCRRITITECGQI
GenBank ID Protein 150418007
UniProtKB/Swiss-Prot ID P49792
UniProtKB/Swiss-Prot Entry Name RBP2_HUMAN
PDB IDs
GenBank Gene ID NM_006267.4
GeneCard ID RANBP2
GenAtlas ID RANBP2
HGNC ID HGNC:9848
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  7. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  8. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  9. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  10. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  11. Han G, Ye M, Zhou H, Jiang X, Feng S, Jiang X, Tian R, Wan D, Zou H, Gu J: Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography. Proteomics. 2008 Apr;8(7):1346-61. doi: 10.1002/pmic.200700884. [PubMed:18318008 ]
  12. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  13. Pichler A, Knipscheer P, Saitoh H, Sixma TK, Melchior F: The RanBP2 SUMO E3 ligase is neither HECT- nor RING-type. Nat Struct Mol Biol. 2004 Oct;11(10):984-91. Epub 2004 Sep 19. [PubMed:15378033 ]
  14. Tatham MH, Kim S, Jaffray E, Song J, Chen Y, Hay RT: Unique binding interactions among Ubc9, SUMO and RanBP2 reveal a mechanism for SUMO paralog selection. Nat Struct Mol Biol. 2005 Jan;12(1):67-74. Epub 2004 Dec 19. [PubMed:15608651 ]
  15. Li T, Santockyte R, Shen RF, Tekle E, Wang G, Yang DC, Chock PB: A general approach for investigating enzymatic pathways and substrates for ubiquitin-like modifiers. Arch Biochem Biophys. 2006 Sep 1;453(1):70-4. Epub 2006 Mar 20. [PubMed:16620772 ]
  16. Reverter D, Lima CD: Insights into E3 ligase activity revealed by a SUMO-RanGAP1-Ubc9-Nup358 complex. Nature. 2005 Jun 2;435(7042):687-92. [PubMed:15931224 ]
  17. Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R: Phosphoproteome analysis of the human mitotic spindle. Proc Natl Acad Sci U S A. 2006 Apr 4;103(14):5391-6. Epub 2006 Mar 24. [PubMed:16565220 ]
  18. Vetter IR, Nowak C, Nishimoto T, Kuhlmann J, Wittinghofer A: Structure of a Ran-binding domain complexed with Ran bound to a GTP analogue: implications for nuclear transport. Nature. 1999 Mar 4;398(6722):39-46. [PubMed:10078529 ]
  19. Kirsh O, Seeler JS, Pichler A, Gast A, Muller S, Miska E, Mathieu M, Harel-Bellan A, Kouzarides T, Melchior F, Dejean A: The SUMO E3 ligase RanBP2 promotes modification of the HDAC4 deacetylase. EMBO J. 2002 Jun 3;21(11):2682-91. [PubMed:12032081 ]
  20. Um JW, Min DS, Rhim H, Kim J, Paik SR, Chung KC: Parkin ubiquitinates and promotes the degradation of RanBP2. J Biol Chem. 2006 Feb 10;281(6):3595-603. Epub 2005 Dec 6. [PubMed:16332688 ]
  21. Wu J, Matunis MJ, Kraemer D, Blobel G, Coutavas E: Nup358, a cytoplasmically exposed nucleoporin with peptide repeats, Ran-GTP binding sites, zinc fingers, a cyclophilin A homologous domain, and a leucine-rich region. J Biol Chem. 1995 Jun 9;270(23):14209-13. [PubMed:7775481 ]
  22. Yokoyama N, Hayashi N, Seki T, Pante N, Ohba T, Nishii K, Kuma K, Hayashida T, Miyata T, Aebi U, et al.: A giant nucleopore protein that binds Ran/TC4. Nature. 1995 Jul 13;376(6536):184-8. [PubMed:7603572 ]
  23. Beddow AL, Richards SA, Orem NR, Macara IG: The Ran/TC4 GTPase-binding domain: identification by expression cloning and characterization of a conserved sequence motif. Proc Natl Acad Sci U S A. 1995 Apr 11;92(8):3328-32. [PubMed:7724562 ]
  24. Pichler A, Gast A, Seeler JS, Dejean A, Melchior F: The nucleoporin RanBP2 has SUMO1 E3 ligase activity. Cell. 2002 Jan 11;108(1):109-20. [PubMed:11792325 ]
  25. Song J, Durrin LK, Wilkinson TA, Krontiris TG, Chen Y: Identification of a SUMO-binding motif that recognizes SUMO-modified proteins. Proc Natl Acad Sci U S A. 2004 Oct 5;101(40):14373-8. Epub 2004 Sep 23. [PubMed:15388847 ]
  26. Klein UR, Haindl M, Nigg EA, Muller S: RanBP2 and SENP3 function in a mitotic SUMO2/3 conjugation-deconjugation cycle on Borealin. Mol Biol Cell. 2009 Jan;20(1):410-8. doi: 10.1091/mbc.E08-05-0511. Epub 2008 Oct 22. [PubMed:18946085 ]
  27. Geyer JP, Doker R, Kremer W, Zhao X, Kuhlmann J, Kalbitzer HR: Solution structure of the Ran-binding domain 2 of RanBP2 and its interaction with the C terminus of Ran. J Mol Biol. 2005 May 6;348(3):711-25. [PubMed:15826666 ]
  28. Neilson DE, Adams MD, Orr CM, Schelling DK, Eiben RM, Kerr DS, Anderson J, Bassuk AG, Bye AM, Childs AM, Clarke A, Crow YJ, Di Rocco M, Dohna-Schwake C, Dueckers G, Fasano AE, Gika AD, Gionnis D, Gorman MP, Grattan-Smith PJ, Hackenberg A, Kuster A, Lentschig MG, Lopez-Laso E, Marco EJ, Mastroyianni S, Perrier J, Schmitt-Mechelke T, Servidei S, Skardoutsou A, Uldall P, van der Knaap MS, Goglin KC, Tefft DL, Aubin C, de Jager P, Hafler D, Warman ML: Infection-triggered familial or recurrent cases of acute necrotizing encephalopathy caused by mutations in a component of the nuclear pore, RANBP2. Am J Hum Genet. 2009 Jan;84(1):44-51. doi: 10.1016/j.ajhg.2008.12.009. [PubMed:19118815 ]