Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08540
Secondary Accession Numbers
  • 14253
Name Rab11 family-interacting protein 2
Synonyms
  1. NRip11
  2. Rab11-FIP2
Gene Name RAB11FIP2
Protein Type Unknown
Biological Properties
General Function Involved in protein transport
Specific Function A Rab11 effector protein acting in the regulation of the transport of vesicles from the endosomal recycling compartment (ERC) to the plasma membrane. Also involved in receptor-mediated endocytosis and membrane trafficking of recycling endosomes, probably originating from clathrin-coated vesicles. Binds preferentially to phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and phosphatidic acid (PA)
Pathways Not Available
Reactions Not Available
GO Classification
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
Process
establishment of localization
transport
protein transport
Cellular Location
  1. Cell membrane
  2. Peripheral membrane protein
  3. Peripheral membrane protein
  4. Recycling endosome membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 10q26.11
SNPs RAB11FIP2
Gene Sequence
>1539 bp
ATGATGCTGTCCGAGCAAGCCCAAAAGTGGTTTCCAACCCACGTGCAGGTCACAGTGCTC
CAAGCCAAAGATCTGAAGCCAAAAGGCAAAAGTGGTACCAATGACACATACACTATAATT
CAGCTGGGCAAGGAAAAGTACTCCACCTCTGTAGCTGAGAAAACCCTTGAGCCAGTTTGG
AAGGAGGAGGCCTCTTTCGAGCTACCTGGATTGCTAATTCAGGGAAGTCCAGAGAAATAC
ATTCTTTTCCTTATAGTTATGCACAGGTCCCTGGTGGGTCTGGATAAATTTTTAGGGCAG
GTGGCAATCAATCTCAATGACATCTTTGAGGACAAACAAAGAAGGAAAACAGAGTGGTTT
AGATTAGAATCCAAACAAGGAAAACGAATCAAAAACAGGGGTGAGATAAAGGTCAATATT
CAGTTTATGAGGAACAATATGACCGCAAGTATGTTTGACTTATCAATGAAGGACAAAACC
AGATCTCCTTTTGCAAAGTTAAAAGATAAGATGAAGGGTAGAAAAAATGATGGAACATTT
TCTGATACGTCTTCTGCAATCATTCCAAGTACTCACATGCCCGATGCCAATAGTGAATTT
TCAAGTGGTGAAATACAGATGAAATCCAAACCAAAAAAGCCTTTTCTCTTGGGTCCTCAG
CGACTCTCGTCAGCGCATTCAATGTCTGATTTATCTGGGTCCCATATGTCTTCTGAGAAA
CTGAAGGCTGGCACCATAGGTCAAACACATCTTCTCGGACACCAGTTAGATTCCTTTGGA
ACAGTTCCAGAAAGTGGAAGTCTCAAATCTCCACACAGAAGAACATTAAGCTTTGATACT
TCTAAAATGAACCAACCTGACAGCATTGTGGATGAAGGTGAATTGTGTTTCGGAAGACAA
AATGACCCATTTACAAATGTGACTGCTTCATTACCCCAAAAATTTGCAACACTGCCAAGG
AAGAAAAATCCATTTGAAGAAAGCAGCGAAACATGGGACAGCAGCATGAATTTATTTTCA
AAACCAATTGAAATAAGAAAAGAAAATAAAAGAGAGAAAAGGGAGAAAGTTAGCCTGTTT
GAAAGAGTGACTGGAAAAAAAGATAGCAGAAGATCTGATAAACTTAACAATGGGGGATCT
GATAGCCCTTGTGACTTGAAATCACCTAATGCATTTAGTGAAAATCGCCAGGACTATTTT
GATTATGAGTCAACCAATCCATTTACAGCAAAATTCAGGGCTTCAAATATAATGCCATCT
TCAAGTTTTCATATGAGTCCAACAAGCAATGAAGACCTCAGGAAAATCCCGGACAGCAAC
CCCTTTGATGCCACTGCAGGGTATCGTAGTCTGACCTATGAAGAGGTTCTACAGGAGCTG
GTGAAACACAAAGAACTCCTTAGGAGGAAAGACACCCACATCCGGGAACTCGAGGACTAC
ATCGACAACCTCCTTGTAAGGGTAATGGAAGAAACGCCCAGTATTCTCAGAGTGCCGTAT
GAACCATCCAGGAAAGCTGGCAAATTCTCTAACAGTTAA
Protein Properties
Number of Residues 512
Molecular Weight 58278.6
Theoretical pI 9.95
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rab11 family-interacting protein 2
MMLSEQAQKWFPTHVQVTVLQAKDLKPKGKSGTNDTYTIIQLGKEKYSTSVAEKTLEPVW
KEEASFELPGLLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF
RLESKQGKRIKNRGEIKVNIQFMRNNMTASMFDLSMKDKTRSPFAKLKDKMKGRKNDGTF
SDTSSAIIPSTHMPDANSEFSSGEIQMKSKPKKPFLLGPQRLSSAHSMSDLSGSHMSSEK
LKAGTIGQTHLLGHQLDSFGTVPESGSLKSPHRRTLSFDTSKMNQPDSIVDEGELCFGRQ
NDPFTNVTASLPQKFATLPRKKNPFEESSETWDSSMNLFSKPIEIRKENKREKREKVSLF
ERVTGKKDSRRSDKLNNGGSDSPCDLKSPNAFSENRQDYFDYESTNPFTAKFRASNIMPS
SSFHMSPTSNEDLRKIPDSNPFDATAGYRSLTYEEVLQELVKHKELLRRKDTHIRELEDY
IDNLLVRVMEETPSILRVPYEPSRKAGKFSNS
GenBank ID Protein 7662394
UniProtKB/Swiss-Prot ID Q7L804
UniProtKB/Swiss-Prot Entry Name RFIP2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_014904.2
GeneCard ID RAB11FIP2
GenAtlas ID RAB11FIP2
HGNC ID HGNC:29152
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  5. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Feb 26;6(1):63-70. [PubMed:10231032 ]
  6. Hales CM, Griner R, Hobdy-Henderson KC, Dorn MC, Hardy D, Kumar R, Navarre J, Chan EK, Lapierre LA, Goldenring JR: Identification and characterization of a family of Rab11-interacting proteins. J Biol Chem. 2001 Oct 19;276(42):39067-75. Epub 2001 Aug 8. [PubMed:11495908 ]
  7. Wallace DM, Lindsay AJ, Hendrick AG, McCaffrey MW: The novel Rab11-FIP/Rip/RCP family of proteins displays extensive homo- and hetero-interacting abilities. Biochem Biophys Res Commun. 2002 Apr 12;292(4):909-15. [PubMed:11944901 ]
  8. Wallace DM, Lindsay AJ, Hendrick AG, McCaffrey MW: Rab11-FIP4 interacts with Rab11 in a GTP-dependent manner and its overexpression condenses the Rab11 positive compartment in HeLa cells. Biochem Biophys Res Commun. 2002 Dec 20;299(5):770-9. [PubMed:12470645 ]
  9. Lindsay AJ, McCaffrey MW: Rab11-FIP2 functions in transferrin recycling and associates with endosomal membranes via its COOH-terminal domain. J Biol Chem. 2002 Jul 26;277(30):27193-9. Epub 2002 May 6. [PubMed:11994279 ]
  10. Cullis DN, Philip B, Baleja JD, Feig LA: Rab11-FIP2, an adaptor protein connecting cellular components involved in internalization and recycling of epidermal growth factor receptors. J Biol Chem. 2002 Dec 20;277(51):49158-66. Epub 2002 Oct 2. [PubMed:12364336 ]
  11. Junutula JR, Schonteich E, Wilson GM, Peden AA, Scheller RH, Prekeris R: Molecular characterization of Rab11 interactions with members of the family of Rab11-interacting proteins. J Biol Chem. 2004 Aug 6;279(32):33430-7. Epub 2004 Jun 1. [PubMed:15173169 ]
  12. Lindsay AJ, McCaffrey MW: The C2 domains of the class I Rab11 family of interacting proteins target recycling vesicles to the plasma membrane. J Cell Sci. 2004 Sep 1;117(Pt 19):4365-75. Epub 2004 Aug 10. [PubMed:15304524 ]
  13. Jagoe WN, Lindsay AJ, Read RJ, McCoy AJ, McCaffrey MW, Khan AR: Crystal structure of rab11 in complex with rab11 family interacting protein 2. Structure. 2006 Aug;14(8):1273-83. [PubMed:16905101 ]