Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08543
Secondary Accession Numbers
  • 14256
Name Ral guanine nucleotide dissociation stimulator-like 2
Synonyms
  1. RalGDS-like 2
  2. RalGDS-like factor
  3. Ras-associated protein RAB2L
Gene Name RGL2
Protein Type Unknown
Biological Properties
General Function Involved in signal transduction
Specific Function Probable guanine nucleotide exchange factor. Putative effector of Ras and/or Rap. Associates with the GTP-bound form of Rap 1A and H-Ras in vitro
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
enzyme regulator activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signal transduction
small gtpase mediated signal transduction
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:6
Locus 6p21.3
SNPs RGL2
Gene Sequence
>2334 bp
ATGCTCCCGCGGCCCCTGCGGCTGCTTTTGGACACGAGCCCCCCCGGGGGAGTCGTACTG
AGCAGCTTCCGAAGCCGGGACCCCGAAGAGGGTGGGGGCCCAGGTGGCCTGGTCGTGGGC
GGGGGGCAGGAGGAAGAGGAGGAGGAAGAAGAAGAGGCCCCTGTGTCCGTCTGGGATGAG
GAGGAGGATGGTGCCGTGTTTACCGTCACAAGCCGCCAATATCGACCTCTTGATCCCTTG
GTCCCTATGCCTCCCCCACGTTCCTCCCGACGGCTCCGAGCTGGCACTCTGGAGGCCCTG
GTCAGACACCTACTGGATACCCGGACATCAGGGACTGATGTGAGCTTCATGTCAGCCTTC
CTGGCTACCCACCGGGCCTTCACCTCCACGCCTGCCTTGCTAGGGCTTATGGCTGACAGG
CTGGAAGCCCTTGAATCTCATCCTACCGACGAACTAGAGAGGACAACAGAGGTAGCCATC
TCTGTACTGTCAACCTGGCTGGCCTCTCACCCTGAGGATTTTGGCTCTGAGGCCAAGGGT
CAGCTTGACCGGCTTGAGAGCTTCTTACTTCAGACAGGGTATGCAGCAGGGAAGGGTGTT
GGGGGGGGCAGCGCTGACCTCATCCGCAATCTCCGGTCCCGGGTGGACCCCCAGGCCCCC
GACCTTCCTAAGCCCCTGGCCCTCCCCGGCGATCCCCCTGCTGACCCCACGGATGTCCTG
GTGTTCCTCGCTGACCACTTGGCCGAACAGCTGACCCTGCTAGATGCGGAACTTTTTCTC
AATTTGATCCCCTCTCAGTGCCTGGGAGGCCTGTGGGGTCACAGAGACCGGCCAGGACAT
TCTCACCTCTGCCCATCTGTCCGAGCTACTGTCACACAGTTTAACAAGGTGGCAGGGGCA
GTGGTTAGTTCTGTCCTGGGGGCTACTTCCACTGGAGAGGGACCTGGGGAGGTGACCATA
CGGCCACTCCGTCCCCCACAGAGGGCCCGGCTCCTGGAGAAGTGGATCCGCGTGGCAGAG
GAGTGCCGGCTGCTCCGAAACTTCTCTTCAGTTTATGCCGTGGTGTCAGCCCTGCAGTCC
AGCCCCATCCACAGGCTTCGGGCAGCCTGGGGGGAAGCAACCAGGGACAGCCTCAGAGTC
TTTTCCAGCCTCTGCCAGATTTTCTCCGAGGAGGATAATTATTCCCAGAGTCGGGAGCTG
CTCGTGCAGGAGGTGAAGCTGCAGTCTCCTCTGGAGCCACACTCCAAGAAGGCCCCGAGG
TCTGGCTCCCGGGGTGGGGGTGTGGTCCCATACCTTGGCACCTTCCTGAAGGACCTTGTG
ATGCTGGATGCAGCCTCCAAGGATGAGTTGGAGAATGGATACATCAATTTTGACAAGCGG
AGGAAGGAGTTTGCAGTCCTTTCTGAGTTGCGACGGCTCCAGAATGAATGTCGTGGCTAT
AACCTCCAACCTGACCATGATATCCAGAGGTGGCTACAGGGGCTCCGGCCACTGACAGAG
GCTCAGAGCCATCGTGTATCCTGTGAGGTGGAGCCACCTGGTTCCAGTGACCCTCCTGCC
CCACGGGTGCTTCGGCCAACATTGGTCATCTCGCAGTGGACAGAGGTTTTGGGCTCTGTT
GGGGTCCCTACCCCGCTTGTGTCCTGTGACCGGCCCAGTACTGGGGGAGATGAGGCGCCT
ACAACTCCTGCTCCTCTGCTGACTCGGCTGGCCCAGCACATGAAGTGGCCATCTGTCTCG
TCACTAGACTCTGCCTTGGAAAGCAGTCCATCCCTGCACAGTCCAGCTGACCCCAGCCAC
CTCTCCCCACCAGCCTCCTCCCCTAGGCCTTCTCGAGGTCACCGCCGCTCAGCCTCCTGT
GGCTCCCCGCTGAGTGGGGGTGCAGAAGAGGCCTCCGGGGGGACTGGATATGGGGGAGAG
GGATCTGGGCCAGGGGCCTCTGATTGCCGTATCATCCGAGTCCAGATGGAGTTGGGGGAA
GATGGCAGTGTCTATAAGAGCATTTTGGTGACAAGCCAGGACAAGGCTCCAAGTGTCATC
AGTCGTGTCCTTAAGAAAAACAATCGTGACTCTGCAGTGGCTTCAGAGTATGAGCTGGTA
CAGCTGCTACCAGGGGAGCGAGAGCTGACTATCCCAGCCTCGGCTAATGTATTCTACGCC
ATGGATGGAGCTTCACACGATTTCCTCCTGCGGCAGCGGCGAAGGTCCTCTACTGCTACA
CCTGGCGTCACCAGTGGCCCGTCTGCCTCAGGAACTCCTCCGAGTGAGGGAGGAGGGGGC
TCCTTTCCCAGGATCAAGGCCACAGGGAGGAAGATTGCACGGGCACTGTTCTGA
Protein Properties
Number of Residues 777
Molecular Weight 83548.1
Theoretical pI 6.09
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ral guanine nucleotide dissociation stimulator-like 2
MLPRPLRLLLDTSPPGGVVLSSFRSRDPEEGGGPGGLVVGGGQEEEEEEEEEAPVSVWDE
EEDGAVFTVTSRQYRPLDPLVPMPPPRSSRRLRAGTLEALVRHLLDTRTSGTDVSFMSAF
LATHRAFTSTPALLGLMADRLEALESHPTDELERTTEVAISVLSTWLASHPEDFGSEAKG
QLDRLESFLLQTGYAAGKGVGGGSADLIRNLRSRVDPQAPDLPKPLALPGDPPADPTDVL
VFLADHLAEQLTLLDAELFLNLIPSQCLGGLWGHRDRPGHSHLCPSVRATVTQFNKVAGA
VVSSVLGATSTGEGPGEVTIRPLRPPQRARLLEKWIRVAEECRLLRNFSSVYAVVSALQS
SPIHRLRAAWGEATRDSLRVFSSLCQIFSEEDNYSQSRELLVQEVKLQSPLEPHSKKAPR
SGSRGGGVVPYLGTFLKDLVMLDAASKDELENGYINFDKRRKEFAVLSELRRLQNECRGY
NLQPDHDIQRWLQGLRPLTEAQSHRVSCEVEPPGSSDPPAPRVLRPTLVISQWTEVLGSV
GVPTPLVSCDRPSTGGDEAPTTPAPLLTRLAQHMKWPSVSSLDSALESSPSLHSPADPSH
LSPPASSPRPSRGHRRSASCGSPLSGGAEEASGGTGYGGEGSGPGASDCRIIRVQMELGE
DGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEYELVQLLPGERELTIPASANVFYA
MDGASHDFLLRQRRRSSTATPGVTSGPSASGTPPSEGGGGSFPRIKATGRKIARALF
GenBank ID Protein 4886477
UniProtKB/Swiss-Prot ID O15211
UniProtKB/Swiss-Prot Entry Name RGL2_HUMAN
PDB IDs
GenBank Gene ID AL050259
GeneCard ID RGL2
GenAtlas ID RGL2
HGNC ID HGNC:9769
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166 ]
  4. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  5. Herberg JA, Beck S, Trowsdale J: TAPASIN, DAXX, RGL2, HKE2 and four new genes (BING 1, 3 to 5) form a dense cluster at the centromeric end of the MHC. J Mol Biol. 1998 Apr 10;277(4):839-57. [PubMed:9545376 ]
  6. Isomura M, Okui K, Fujiwara T, Shin S, Nakamura Y: Isolation and mapping of RAB2L, a human cDNA that encodes a protein homologous to RalGDS. Cytogenet Cell Genet. 1996;74(4):263-5. [PubMed:8976381 ]