Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08549
Secondary Accession Numbers
  • 14262
Name Rho GTPase-activating protein 21
Synonyms
  1. Rho GTPase-activating protein 10
  2. Rho-type GTPase-activating protein 21
Gene Name ARHGAP21
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Functions as a GTPase-activating protein (GAP) for RHOA and CDC42. Downstream partner of ARF1 which may control Golgi apparatus structure and function. Also required for CTNNA1 recruitment to adherens junctions
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
binding
protein binding
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
Cellular Location
  1. Cytoplasm
  2. Golgi apparatus membrane
  3. Peripheral membrane protein
  4. Peripheral membrane protein
  5. cytoskeleton
  6. Cell junction
  7. Cytoplasmic vesicle membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 10p12.1|10p12.3
SNPs ARHGAP21
Gene Sequence
>5874 bp
ATGGCCACGCGTCGGACTGGTCTGTCTGAGGGAGATGGTGACAAGCTCAAGGCCTGCGAG
GTCTCAAAAAATAAAGATGGAAAAGAACAAAGTGAAACTGTATCACTGTCTGAAGATGAA
ACATTCTCCTGGCCAGGTCCCAAAACAGTTACGTTGAAAAGAACATCTCAAGGCTTTGGT
TTTACATTAAGACATTTTATTGTTTATCCCCCAGAGTCTGCAATTCAATTTTCATATAAG
GATGAAGAAAATGGAAACAGAGGAGGAAAACAAAGAAACCGCTTGGAACCAATGGATACC
ATATTTGTTAAGCAAGTTAAAGAAGGAGGACCTGCTTTTGAAGCTGGATTATGTACAGGT
GACCGAATTATAAAAGTCAATGGAGAAAGTGTTATTGGCAAAACCTATTCCCAAGTAATT
GCTTTAATTCAAAACAGTGATACAACATTGGAACTTAGTGTTATGCCAAAAGATGAAGAC
ATTCTCCAAGTGCTACAGTTTACAAAGGATGTCACAGCACTGGCATATTCTCAAGATGCC
TACCTGAAAGGCAACGAAGCTTATAGCGGCAATGCCCGCAATATACCTGAACCTCCACCA
ATCTGCTATCCCTGGCTGCCATCTGCCCCATCAGCCATGGCACAGCCAGTTGAAATATCT
CCTCCTGACTCATCATTGAGCAAACAGCAAACCAGTACACCAGTACTGACACAACCTGGT
AGGGCCTATAGAATGGAAATACAAGTGCCTCCATCACCAACAGATGTTGCAAAATCAAAC
ACAGCAGTGTGTGTTTGCAATGAAAGTGTAAGGACTGTCATTGTGCCTTCTGAGAAGGTT
GTAGATTTGTTATCCAATAGAAACAACCATACAGGTCCTTCACATAGAACTGAAGAAGTG
AGGTATGGCGTGAATGAGCAGACCTCTTTAAAAACAGTGTCAAGAACCACATCACCACCA
TTATCAATTCCCACCACTCATCTAATTCATCAGCCTGCAGGCTCCAGATCACTGGAACCT
TCTGGAATTTTACTTAAGTCTGGAAATTACAGTGGACATTCTGATGGAATCTCAAGCAGC
AGATCTCAAGCTGTGGAGGCTCCCTCTGTATCTGTTAATCACTATTCGCCAAATTCCCAT
CAGCACATAGACTGGAAAAACTATAAAACTTACAAAGAGTATATTGATAACAGACGATTG
CACATAGGTTGTCGGACAATACAAGAAAGATTAGATAGTTTAAGAGCAGCATCTCAAAGC
ACGACAGATTATAACCAGGTCGTCCCCAACCGCACTACTTTGCAGGGACGACGTCGAAGC
ACCTCTCATGATCGAGTGCCCCAGTCTGTCCAGATACGGCAACGCAGTGTGTCCCAAGAA
AGACTGGAAGATTCTGTGCTAATGAAGTATTGTCCAAGAAGTGCATCTCAAGGAGCACTG
ACGTCTCCATCTGTTAGTTTTAGTAATCATAGAACTCGTTCATGGGATTATATTGAGGGA
CAGGATGAAACCTTAGAAAATGTCAATTCTGGAACTCCAATACCTGATTCCAATGGAGAG
AAAAAACAGACTTACAAGTGGAGTGGGTTTACTGAACAGGATGATAGACGAGGTATTTGT
GAAAGACCTAGGCAGCAAGAAATTCATAAATCTTTTCGAGGTTCCAATTTTACTGTGGCT
CCAAGCGTTGTTAATTCTGATAACAGGCGAATGAGTGGTAGAGGAGTGGGATCTGTGTCG
CAGTTTAAAAAAATTCCACCAGATCTAAAAACATTGCAGTCAAACAGAAATTTTCAGACT
ACTTGTGGAATGTCACTGCCTCGGGGTATTTCACAAGACAGGTCACCTCTTGTGAAAGTC
CGAAGTAATTCTCTGAAAGCTCCTTCCACGCATGTCACAAAACCATCATTTAGCCAGAAA
TCATTTGTTTCTATCAAAGACCAAAGACCAGTAAATCACTTGCATCAGAACAGTCTGTTG
AATCAGCAGACATGGGTAAGGACTGACAGTGCCCCCGATCAGCAAGTGGAGACTGGGAAA
TCCCCCTCTTTATCTGGAGCCTCTGCCAAGCCTGCCCCTCAGTCGAGTGAAAACGCTGGT
ACTTCAGATTTAGAACTACCTGTCAGTCAAAGGAGTCAAGATTTAAGTTTACAAGAGGCT
GAAACTGAGCAATCAGATACTTTAGATAATAAAGAAGCTGTCATCCTAAGGGAAAAACCT
CCATCTGGACGCCAGACACCGCAGCCTTTAAGGCATCAGTCTTACATCTTGGCAGTAAAT
GACCAGGAGACCGGGTCAGACACTACCTGCTGGCTGCCCAATGATGCACGTCGAGAGGTC
CACATAAAAAGAATGGAGGAAAGAAAAGCCTCGAGTACCAGTCCGCCTGGCGATTCTTTG
GCTTCCATCCCATTTATAGATGAACCAACTAGCCCTAGCATTGATCATGATATTGCACAT
ATCCCTGCCTCTGCTGTTATATCAGCCTCTACCTCTCAGGTCCCCTCCATAGCAACAGTT
CCTCCTTGCCTCACAACTTCAGCTCCATTAATTCGCCGTCAGCTCTCACATGACCACGAA
TCTGTTGGCCCTCCTAGCCTGGATGCTCAGCCCAACTCAAAGACAGAAAGATCAAAATCA
TATGATGAGGGTCTGGATGATTACAGAGAAGATGCAAAATTGTCCTTTAAGCACGTACCT
AGTCTGAAGGGAATCAAGATCGCAGACAGCCAAAAGTCATCAGAAGACTCTGGGTCCAGA
AAAGATTCTTCCTCAGAGGTCTTCAGTGATGCTGCCAAGGAAGGGTGGCTTCATTTCCGA
CCCCTTGTCACCGATAAGGGCAAGCGAGTTGGTGGAAGTATTCGGCCATGGAAACAGATG
TATGTTGTCCTTCGGGGTCATTCACTTTACCTGTACAAAGATAAAAGAGAGCAGACGACT
CCGTCTGAGGAAGAGCAGCCCATCAGTGTTAATGCTTGCTTGATAGACATCTCTTACAGT
GAGACCAAGAGGAAAAATGTGTTTCGACTCACCACGTCCGACTGTGAATGCCTGTTTCAG
GCTGAAGACAGAGATGATATGCTAGCTTGGATCAAGACGATCCAGGAGAGCAGCAACCTA
AACGAAGAGGACACTGGAGTCACTAACAGGGATCTAATTAGTCGAAGAATAAAAGAATAC
AACAATCTGATGAGCAAAGCAGAACAGTTGCCAAAAACACCTCGCCAGAGTCTCAGCATC
AGGCAAACTTTGCTTGGTGCTAAATCAGAGCCAAAGACTCAAAGCCCACACTCTCCGAAG
GAAGAGTCGGAAAGGAAACTTCTCAGTAAAGATGATACCAGTCCCCCAAAAGACAAAGGC
ACATGGAGAAAAGGCATTCCAAGTATCATGAGAAAGACATTTGAGAAAAAGCCAACTGCT
ACAGGAACTTTCGGCGTCCGACTAGATGACTGCCCACCAGCTCATACTAATCGGTATATT
CCATTAATAGTTGACATATGTTGCAAATTAGTTGAAGAAAGAGGTCTTGAATATACAGGT
ATTTATAGAGTTCCTGGAAATAATGCAGCCATCTCAAGTATGCAAGAAGAACTCAACAAG
GGAATGGCTGATATTGATATACAAGATGATAAATGGCGAGATTTGAATGTGATAAGCAGT
TTACTAAAATCCTTCTTCAGAAAACTCCCTGAGCCTCTCTTCACAAATGATAAATATGCT
GATTTTATTGAAGCCAATCGTAAAGAAGATCCTCTAGATCGTCTGAAAACATTAAAAAGA
CTAATTCACGATTTGCCTGAACATCATTATGAAACACTTAAGTTCCTTTCAGCTCATCTG
AAGACAGTGGCAGAAAATTCAGAAAAAAATAAGATGGAACCAAGAAACCTAGCAATAGTG
TTTGGTCCCACCCTTGTTCGAACATCAGAAGACAACATGACCCACATGGTCACCCACATG
CCTGACCAGTACAAGATTGTAGAAACGCTCATCCAGCACCATGACTGGTTTTTCACAGAA
GAAGGTGCTGAAGAGCCTCTTACAACAGTGCAGGAGGAAAGCACAGTAGACTCCCAGCCA
GTGCCAAACATAGATCATTTACTCACCAACATTGGAAGGACAGGAGTCTCCCCAGGAGAT
GTATCAGATTCAGCTACTAGTGACTCAACAAAATCTAAGGGTTCTTGGGGATCTGGAAAG
GATCAGTATAGCAGGGAACTGCTTGTGTCCTCCATCTTTGCAGCTGCTAGTCGCAAGAGG
AAGAAGCCGAAAGAAAAAGCACAGCCTAGCAGCTCAGAAGATGAACTGGACAATGTATTT
TTTAAGAAAGAAAATGTGGAACAGTGTCACAATGATACTAAAGAGGAGTCCAAAAAAGAA
AGTGAGACACTGGGCAGAAAACAGAAGATCATCATTGCCAAAGAAAACAGCACTAGGAAA
GACCCCAGCACGACAAAAGATGAAAAGATATCACTAGGAAAAGAGAGCACGCCTTCTGAA
GAACCCTCACCACCACACAACTCAAAACACAACAAGTCACCAACTCTCAGCTGTCGCTTT
GCCATCCTGAAAGAGAGCCCCAGGTCACTTCTGGCACAGAAGTCCTCCCACCTTGAAGAG
ACAGGCTCTGACTCTGGCACTTTGCTCAGCACGTCTTCCCAGGCCTCCCTGGCAAGGTTT
TCCATGAAGAAATCAACCAGTCCAGAAACGAAACATAGCGAGTTTTTGGCCAACGTCAGC
ACCATCACCTCAGATTATTCCACCACATCGTCTGCTACATACTTGACTAGCCTGGACTCC
AGTCGACTGAGCCCTGAGGTGCAATCCGTGGCAGAGAGCAAGGGGGACGAGGCAGATGAC
GAGAGAAGCGAACTCATCAGTGAAGGGCGGCCTGTGGAAACCGACAGCGAGAGCGAGTTT
CCCGTGTTCCCCACAGCCTTGACTTCAGAGAGGCTTTTCCGAGGAAAACTGCAAGAAGTG
ACTAAGAGCAGCCGGAGAAATTCTGAAGGAAGTGAATTAAGTTGCACCGAGGGAAGTTTA
ACATCAAGTTTAGATAGCCGGAGACAGCTCTTCAGTTCCCATAAACTCATCGAATGTGAT
ACTCTTTCCAGGAAAAAATCAGCTAGATTCAAGTCAGATAGTGGAAGTCTAGGAGATGCC
AAGAATGAGAAAGAAGCACCTTCGTTAACTAAAGTGTTTGATGTTATGAAAAAAGGAAAG
TCAACTGGGAGTTTACTGACACCCACCAGAGGCGAATCCGAAAAACAGGAACCCACATGG
AAAACGAAAATAGCAGATCGGTTAAAACTGAGACCCAGAGCCCCTGCGGATGACATGTTT
GGAGCAGGGAATCACAAAGTGAATGCCGAGACTGCTAAAAGGAAAAGCATCCGGCGCAGA
CATACACTAGGAGGGCACAGAGATGCTACCGAAATCAGCGTTTTGAATTTTTGGAAAGTG
CATGAGCAGAGCGGGGAGAGAGAATCTGAACTTTCAGCTGTAAACCGGTTAAAACCAAAA
TGCTCAGCCCAGGACCTTTCCATCTCAGACTGGCTGGCCAGGGAACGCCTACGCACCAGT
ACCTCTGACCTTAGCAGAGGAGAAATCGGAGATCCCCAGACAGAGAACCCAAGCACACGA
GAAATAGCCACGACCGACACACCTTTGTCTCTTCATTGCAACACAGGCAGTTCTTCCAGC
ACCTTGGCTTCAACAAACAGGCCCCTTCTTTCCATACCACCACAGTCACCTGACCAAATA
AACGGAGAAAGCTTCCAGAACGTGAGCAAAAATGCTAGTTCTGCAGCGAATGCCCAACCT
CATAAACTGTCTGAAACCCCAGGCACTAAAGCAGAGTTTCATCCCTGTCTTTAA
Protein Properties
Number of Residues 1957
Molecular Weight 217328.9
Theoretical pI 7.87
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rho GTPase-activating protein 21
MATRRTGLSEGDGDKLKACEVSKNKDGKEQSETVSLSEDETFSWPGPKTVTLKRTSQGFG
FTLRHFIVYPPESAIQFSYKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFEAGLCTG
DRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDEDILQVLQFTKDVTALAYSQDA
YLKGNEAYSGNARNIPEPPPICYPWLPSAPSAMAQPVEISPPDSSLSKQQTSTPVLTQPG
RAYRMEIQVPPSPTDVAKSNTAVCVCNESVRTVIVPSEKVVDLLSNRNNHTGPSHRTEEV
RYGVSEQTSLKTVSRTTSPPLSIPTTHLIHQPAGSRSLEPSGILLKSGNYSGHSDGISSS
RSQAVEAPSVSVNHYSPNSHQHIDWKNYKTYKEYIDNRRLHIGCRTIQERLDSLRAASQS
TTDYNQVVPNRTTLQGRRRSTSHDRVPQSVQIRQRSVSQERLEDSVLMKYCPRSASQGAL
TSPSVSFSNHRTRSWDYIEGQDETLENVNSGTPIPDSNGEKKQTYKWSGFTEQDDRRGIC
ERPRQQEIHKSFRGSNFTVAPSVVNSDNRRMSGRGVGSVSQFKKIPPDLKTLQSNRNFQT
TCGMSLPRGISQDRSPLVKVRSNSLKAPSTHVTKPSFSQKSFVSIKDQRPVNHLHQNSLL
NQQTWVRTDSAPDQQVETGKSPSLSGASAKPAPQSSENAGTSDLELPVSQRNQDLSLQEA
ETEQSDTLDNKEAVILREKPPSGRQTPQPLRHQSYILAVNDQETGSDTTCWLPNDARREV
HIKRMEERKASSTSPPGDSLASIPFIDEPTSPSIDHDIAHIPASAVISASTSQVPSIATV
PPCLTTSAPLIRRQLSHDHESVGPPSLDAQPNSKTERSKSYDEGLDDYREDAKLSFKHVS
SLKGIKIADSQKSSEDSGSRKDSSSEVFSDAAKEGWLHFRPLVTDKGKRVGGSIRPWKQM
YVVLRGHSLYLYKDKREQTTPSEEEQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQ
AEDRDDMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNNLMSKAEQLPKTPRQSLSI
RQTLLGAKSEPKTQSPHSPKEESERKLLSKDDTSPPKDKGTWRKGIPSIMRKTFEKKPTA
TGTFGVRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELNK
GMADIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLKTLKR
LIHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHM
PDQYKIVETLIQHHDWFFTEEGAEEPLTTVQEESTVDSQPVPNIDHLLTNIGRTGVSPGD
VSDSATSDSTKSKGSWGSGKDQYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDELDNVF
FKKENVEQCHNDTKEESKKESETLGRKQKIIIAKENSTRKDPSTTKDEKISLGKESTPSE
EPSPPHNSKHNKSPTLSCRFAILKESPRSLLAQKSSHLEETGSDSGTLLSTSSQASLARF
SMKKSTSPETKHSEFLANVSTITSDYSTTSSATYLTSLDSSRLSPEVQSVAESKGDEADD
ERSELISEGRPVETDSESEFPVFPTALTSERLFRGKLQEVTKSSRRNSEGSELSCTEGSL
TSSLDSRRQLFSSHKLIECDTLSRKKSARFKSDSGSLGDAKNEKEAPSLTKVFDVMKKGK
STGSLLTPTRGESEKQEPTWKTKIADRLKLRPRAPADDMFGVGNHKVNAETAKRKSIRRR
HTLGGHRDATEISVLNFWKVHEQSGERESELSAVNRLKPKCSAQDLSISDWLARERLRTS
TSDLSRGEIGDPQTENPSTREIATTDTPLSLHCNTGSSSSTLASTNRPLLSIPPQSPDQI
NGESFQNVSKNASSAANAQPHKLSETPGSKAEFHPCL
GenBank ID Protein 20514209
UniProtKB/Swiss-Prot ID Q5T5U3
UniProtKB/Swiss-Prot Entry Name RHG21_HUMAN
PDB IDs Not Available
GenBank Gene ID AF480466
GeneCard ID ARHGAP21
GenAtlas ID ARHGAP21
HGNC ID HGNC:23725
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  6. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  7. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  8. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  9. Nagase T, Kikuno R, Ishikawa KI, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Feb 28;7(1):65-73. [PubMed:10718198 ]
  10. Menetrey J, Perderiset M, Cicolari J, Dubois T, Elkhatib N, El Khadali F, Franco M, Chavrier P, Houdusse A: Structural basis for ARF1-mediated recruitment of ARHGAP21 to Golgi membranes. EMBO J. 2007 Apr 4;26(7):1953-62. Epub 2007 Mar 8. [PubMed:17347647 ]
  11. Carles A, Millon R, Cromer A, Ganguli G, Lemaire F, Young J, Wasylyk C, Muller D, Schultz I, Rabouel Y, Dembele D, Zhao C, Marchal P, Ducray C, Bracco L, Abecassis J, Poch O, Wasylyk B: Head and neck squamous cell carcinoma transcriptome analysis by comprehensive validated differential display. Oncogene. 2006 Mar 16;25(12):1821-31. [PubMed:16261155 ]
  12. Dubois T, Paleotti O, Mironov AA, Fraisier V, Stradal TE, De Matteis MA, Franco M, Chavrier P: Golgi-localized GAP for Cdc42 functions downstream of ARF1 to control Arp2/3 complex and F-actin dynamics. Nat Cell Biol. 2005 Apr;7(4):353-64. Epub 2005 Mar 27. [PubMed:15793564 ]
  13. Basseres DS, Tizzei EV, Duarte AA, Costa FF, Saad ST: ARHGAP10, a novel human gene coding for a potentially cytoskeletal Rho-GTPase activating protein. Biochem Biophys Res Commun. 2002 Jun 14;294(3):579-85. [PubMed:12056806 ]
  14. Katoh M, Katoh M: Characterization of human ARHGAP10 gene in silico. Int J Oncol. 2004 Oct;25(4):1201-6. [PubMed:15375573 ]
  15. Sousa S, Cabanes D, Archambaud C, Colland F, Lemichez E, Popoff M, Boisson-Dupuis S, Gouin E, Lecuit M, Legrain P, Cossart P: ARHGAP10 is necessary for alpha-catenin recruitment at adherens junctions and for Listeria invasion. Nat Cell Biol. 2005 Oct;7(10):954-60. Epub 2005 Sep 25. [PubMed:16184169 ]
  16. Klein S, Franco M, Chardin P, Luton F: Role of the Arf6 GDP/GTP cycle and Arf6 GTPase-activating proteins in actin remodeling and intracellular transport. J Biol Chem. 2006 May 5;281(18):12352-61. Epub 2006 Mar 9. [PubMed:16527809 ]