You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08553
Secondary Accession Numbers
  • 14267
Name Rhophilin-1
Synonyms
  1. GTP-Rho-binding protein 1
Gene Name RHPN1
Protein Type Unknown
Biological Properties
General Function Involved in signal transduction
Specific Function Has no enzymatic activity. May serve as a target for Rho, and interact with some cytoskeletal component upon Rho binding or relay a Rho signal to other molecules
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
binding
protein binding
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:8
Locus 8q24.3
SNPs RHPN1
Gene Sequence
>2088 bp
ATGATCCTGGAGGAGAGGCCGGACGGCGCGGGCGCCGGCGAGGAGAGCCCGCGGCTGCAG
GGCTGTGACTCCCTGACGCAGATCCAGTGCGGCCAGCTGCAGAGCCGCAGGGCCCAGATT
CACCAGCAGATTGACAAGGAGCTGCAGATGCGGACGGGCGCTGAGAACCTCTACAGAGCC
ACCAGCAACAACCGGGTGAGAGAGACGGTCGCCCTGGAGCTGAGCTACGTCAACTCCAAC
CTGCAGCTGCTGAAGGAGGAGCTGGAGGAGCTCAGCGGTGGCGTGGACCCTGGCCGGCAT
GGGAGCGAAGCTGTCACTGTCCCCATGATCCCCCTGGGCCTGAAGGAGACCAAGGAGCTG
GACTGGTCTACACCGCTGAAGGAGCTGATCTCAGTGCACTTTGGAGAGGACGGCGCCTCC
TACGAGGCAGAAATCAGGGAGCTGGAGGCCCTGCGGCAGGCCATGCGGACCCCCAGCCGG
AATGAGTCGGGCCTGGAGCTGCTCACAGCCTATTACAACCAGCTGTGCTTCCTGGATGCG
CGCTTCCTCACCCCTGCCAGGAGCCTCGGGCTCTTCTTCCACTGGTACGACTCGCTTACT
GGGGTCCCGGCCCAGCAGCGTGCCCTGGCCTTCGAGAAGGGCAGCGTTCTCTTCAACATC
GGTGCCCTCCACACGCAGATTGGGGCGCGCCAGGACCGCTCCTGCACCGAGGGTGCCCGC
CGCGCTATGGAGGCCTTCCAGAGGGCCGCTGGGGCCTTCAGCCTCCTGAGGGAGAACTTC
TCCCATGCGCCGAGCCCAGACATGAGCGCTGCGTCCCTCTGCGCACTGGAGCAGCTCATG
ATGGCCCAGGCCCAGGAATGTGTGTTTGAGGGCCTCTCACCACCTGCCTCCATGGCCCCC
CAAGACTGCCTGGCCCAGCTGCGCCTGGCGCAGGAGGCCGCCCAGGTGGCAGCCGAGTAC
AGGCTAGTGCACCGGACCATGGCCCAGCCACCCGTCCACGACTACGTGCCTGTCTCCTGG
ACTGCCCTGGTGCATGTCAAGGCCGAGTACTTCCGCTCCCTGGCCCACTACCACGTAGCC
ATGGCCCTCTGCGACGGCTCCCGTGAGTGCCCACCACACTTGCCCATGGTACTGCCAAGG
CCCCCCCGCGCAGGCTCACAGCCTCTCTGTCCCCCAGCAGCGACCGAGGGAGAGCTCCCC
ACGCACGAGCAGGTCTTCCTGCAGCCCCCCACCTCCTCTAAGCCCCGAGGCCCTGTGCTG
CCGCAGGAGCTGGAGGAGCGCAGGCAGCTTGGCAAGGCACACCTGAAGCGTGCCATCCTG
GGGCAGGAGGAGGCGCTGCGGCTGCACGCCCTGTGCCGCGTCCTGCGCGAGGTGGACCTG
CTTCGGGCTGTGATCTCCCAGACGCTGCAGCGCTCACTGGCCAAGTATGCGGAGCTCGAC
CGTGAGGATGACTTCTGTGAGGCTGCCGAGGCCCCGGACATCCAGCCTAAGACCCACCAG
AAGCCAGAGGCCAGGATGCCACGCCTGTCCCAGGGGAAGGGGCCTGACATCTTCCATCGG
CTGGGGCCCCTGTCTGTGTTCTCAGCCAAGAACCGGTGGCGGCTGGTGGGGCCCGTCCAC
CTGACCCGAGGAGAGGGCGGCTTTGGCCTCACGCTTCGGGGAGACTCGCCTGTCCTCATC
GCTGCCGTCATTCCAGGGAGCCAGGCCGCGGCGGCTGGCCTGAAGGAGGGCGACTACATT
GTGTCAGTGAATGGGCAGCCATGCAGGTGGTGGAGACACGCGGAGGTGGTGACGGAGCTG
AAGGCTGCGGGAGAGGCGGGCGCCAGCCTGCAGGTGGTGTCGCTGCTGCCCAGCTCTAGA
CTGCCCAGCTTGGGGGACCGCCGGCCCGTCCTGCTGGGCCCCAGGGGGCTTCTAAGGAGC
CAGAGGGAGCATGGTTGCAAGACCCCGGCATCCACGTGGGCCAGTCCCCGGCCCCTCCTC
AACTGGAGCCGAAAGGCCCAGCAGGGCAAGACTGGAGGCTGCCCCCAGCCCTGTGCCCCA
GTGAAGCCAGCTCCGCCCTCATCCTTGAAGCACCCAGGGTGGCCGTGA
Protein Properties
Number of Residues 695
Molecular Weight 76291.4
Theoretical pI 7.82
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rhophilin-1
MILEERPDGAGAGEESPRLQGCDSLTQIQCGQLQSRRAQIHQQIDKELQMRTGAENLYRA
TSNNRVRETVALELSYVNSNLQLLKEELEELSGGVDPGRHGSEAVTVPMIPLGLKETKEL
DWSTPLKELISVHFGEDGASYEAEIRELEALRQAMRTPSRNESGLELLTAYYNQLCFLDA
RFLTPARSLGLFFHWYDSLTGVPAQQRALAFEKGSVLFNIGALHTQIGARQDRSCTEGAR
RAMEAFQRAAGAFSLLRENFSHAPSPDMSAASLCALEQLMMAQAQECVFEGLSPPASMAP
QDCLAQLRLAQEAAQVAAEYRLVHRTMAQPPVHDYVPVSWTALVHVKAEYFRSLAHYHVA
MALCDGSRECPPHLPMVLPRPPRAGSQPLCPPAATEGELPTHEQVFLQPPTSSKPRGPVL
PQELEERRQLGKAHLKRAILGQEEALRLHALCRVLREVDLLRAVISQTLQRSLAKYAELD
REDDFCEAAEAPDIQPKTHQKPEARMPRLSQGKGPDIFHRLGPLSVFSAKNRWRLVGPVH
LTRGEGGFGLTLRGDSPVLIAAVIPGSQAAAAGLKEGDYIVSVNGQPCRWWRHAEVVTEL
KAAGEAGASLQVVSLLPSSRLPSLGDRRPVLLGPRGLLRSQREHGCKTPASTWASPRPLL
NWSRKAQQGKTGGCPQPCAPVKPAPPSSLKHPGWP
GenBank ID Protein 19697913
UniProtKB/Swiss-Prot ID Q8TCX5
UniProtKB/Swiss-Prot Entry Name RHPN1_HUMAN
PDB IDs Not Available
GenBank Gene ID AY082588
GeneCard ID RHPN1
GenAtlas ID RHPN1
HGNC ID HGNC:19973
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Nagase T, Kikuno R, Ohara O: Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins. DNA Res. 2001 Aug 31;8(4):179-87. [PubMed:11572484 ]