You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08558
Secondary Accession Numbers
  • 14272
Name Ras and Rab interactor 3
Synonyms
  1. Ras interaction/interference protein 3
Gene Name RIN3
Protein Type Unknown
Biological Properties
General Function Involved in signal transduction
Specific Function Potential Ras effector protein. May function as a guanine nucleotide exchange (GEF), by exchanging bound GDP for free GTP
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
Cellular Location
  1. Cytoplasm
  2. Cytoplasmic vesicle
  3. Early endosome
Gene Properties
Chromosome Location Chromosome:1
Locus 14q32.12
SNPs RIN3
Gene Sequence
>2958 bp
ATGATCCGACACGCCGGGGCGCCCGCGCGCGGGGACCCCACGGGTCCGGTTCCAGTTGTT
GGCAAAGGAGAGGAAGAGGAAGAGGAAGATGGCATGCGGCTTTGTCTGCCAGCCAACCCG
AAAAACTGCCTTCCTCACCGCCGGGGCATCAGCATCCTGGAGAAGCTCATCAAAACATGC
CCGGTGTGGCTGCAGCTGAGTCTGGGCCAGGCAGAGGTGGCCAGGATCCTGCACCGGGTG
GTGGCTGGGATGTTCCTGGTTCGCCGGGACAGCAGCTCGAAGCAGCTGGTGCTCTGTGTC
CACTTTCCTTCTCTGAACGAAAGCTCGGCCGAGGTGCTCGAATACACCATTAAGGAAGAA
AAGTCGATATTGTACCTGGAAGGCTCGGCTCTTGTGTTTGAGGACATCTTCAGATTGATT
GCGTTCTACTGTGTCAGTAGAGACTTACTGCCCTTCACACTGCGGCTACCCCAGGCCATC
CTTGAGGCCAGCAGCTTCACGGACCTTGAGACCATCGCCAACCTGGGTCTGGGTTTCTGG
GACTCCTCGCTGAATCCTCCACAAGAAAGAGGGAAGCCAGCAGAGCCCCCAAGAGACCGG
GCCCCCGGATTCCCCCTAGTCTCCAGCCTCAGGCCCACAGCCCATGACGCAAACTGTGCC
TGTGAAATCGAGCTGTCGGTAGGAAATGACCGCCTGTGGTTTGTGAATCCTATTTTCATC
GAGGACTGCAGCAGCGCCCTGCCCACCGACCAGCCACCTCTTGGAAATTGCCCTGCACGC
CCTTTGCCGCCCACCTCTGATGCCACCTCACCCACCTCCAGGTGGGCCCCACGCCGCCCA
CCACCCCCTCCCCCAGTGCTGCCCCTGCAGCCCTGCAGCCCAGCCCAGCCCCCTGTGCTC
CCTGCTCTTGCCCCCGCCCCTGCCTGTCCTTTGCCCACCTCTCCCCCAGTGCCTGCCCCC
CACGTCACACCCCATGCCCCAGGTCCCCCAGACCATCCGAACCAGCCGCCCATGATGACC
TGCGAGAGACTCCCATGCCCCACTGCAGGCCTGGGCCCCCTCAGGGAGGAAGCGATGAAG
CCAGGGGCAGCCTCCAGTCCCTTGCAGCAGGTCCCCGCCCCGCCACTGCCTGCGAAGAAG
AACCTTCCCACTGCCCCTCCCAGACGCCGCGTTTCCGAGAGGGTGTCCTTAGAAGACCAA
AGTCCGGGGATGGCGGCAGAGGGGGACCAGCTCAGCCTGCCTCCCCAAGGGACCTCAGAC
GGCCCTGAGGACACGCCCCGGGAGAGCACGGAGCAAGGCCAGGACACAGAGGTGAAAGCC
AGCGATCCTCACAGCATGCCAGAGCTGCCCAGGACAGCCAAACAACCCCCAGTCCCGCCC
CCCAGGAAAAAACGGATCTCTCGACAACTGGCCTCGACCCTCCCAGCTCCCTTAGAGAAC
GCTGAGCTCTGCACACAGGCGATGGCCTTGGAGACACCCACGCCGGGTCCACCCAGAGAG
GGCCAAAGCCCTGCTTCTCAGGCTGGGACTCAGCACCCTCCTGCCCAGGCCACTGCCCAT
TCCCAGAGCTCTCCAGAGTTCAAGGGCTCCCTGGCCTCCCTCTCAGACAGCTTGGGGGTG
TCTGTCATGGCCACCGACCAGGACTCCTACTCCACCAGCAGCACGGAGGAGGAGCTGGAG
CAGTTCAGCAGCCCCAGCGTGAAGAAGAAGCCCTCCATGATCCTGGGCAAGGCTCGGCAC
CGGCTGAGCTTTGCCAGTTTCAGCAGCATGTTCCACGCTTTCCTCTCCAACAACCGCAAG
CTGTACAAGAAGGTGGTGGAGCTGGCGCAGGACAAGGGCTCGTACTTTGGCAGCCTGGTG
CAGGACTACAAGGTGTACAGCCTGGAGATGATGGCGCGCCAGACCTCCAGCACGGAGATG
CTGCAGGAGATTCGCACCATGATGACCCAGCTCAAGAGCTACCTGCTGCAGAGCACCGAG
CTCAAGGCCCTGGTGGACCCCGCCCTGCACTCCGAGGAGGAGCTCGAAGCAATTGTAGAG
TCTGCCTTGTACAAATGTGTCCTGAAGCCCCTGAAGGAAGCCATCAACTCATGCCTGCAT
CAGATCCACAGCAAGGATGGTTCGCTGCAGCAGCTCAAGGAGAACCAGTTAGTGATCCTG
GCCACCACCACCACTGACCTAGGTGTGACCACCAGCGTGCCGGAGGTGCCCATGATGGAG
AAGATCCTGCAGAAGTTCACCAGCATGCACAAGGCCTACTCACCTGAGAAGAAGATCTCC
ATCCTGCTCAAGACCTGCAAACTCATCTACGACTCCATGGCCCTCGGCAACCCAGGGAAG
CCCTATGGGGCGGATGACTTCCTGCCTGTGCTCATGTATGTGCTGGCCCGCAGCAACCTC
ACGGAGATGCTTCTCAATGTGGAGTACATGATGGAGCTCATGGACCCCGCCCTGCAGCTG
GGGGAGGGTTCCTACTATCTGACCACCACCTACGGGGCCCTGGAGCACATCAAGAGCTAC
GACAAGATCACGGTGACCCGGCAGCTGAGTGTGGAGGTGCAGGACTCCATCCACCGCTGG
GAGCGCCGGCGTACTCTCAACAAGGCCCGGGCCTCCCGCTCCTCCGTACAGGACTTCATC
TGCGTGTCGTACCTGGAGCCCGAGCAGCAGGCGCGGACGCTGGCGTCGCGGGCGGACACC
CAGGCCCAGGCGCTGTGCGCGCAGTGCGCGGAGAAGTTCGCGGTGGAGCGGCCGCAGGCG
CACCGGCTGTTCGTGCTGGTGGACGGGCGCTGCTTCCAGCTGGCGGACGACGCGCTGCCG
CACTGCATCAAGGGCTACCTGCTGCGCAGCGAGCCCAAGCGCGACTTCCACTTTGTCTAC
CGGCCCCTGGACGGTGGTGGCGGCGGCGGCGGCGGGAGCCCGCCCTGCCTGGTGGTGCGG
GAGCCCAACTTCCTGTGA
Protein Properties
Number of Residues 985
Molecular Weight 107852.4
Theoretical pI 6.58
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ras and Rab interactor 3
MIRHAGAPARGDPTGPVPVVGKGEEEEEEDGMRLCLPANPKNCLPHRRGISILEKLIKTC
PVWLQLSLGQAEVARILHRVVAGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEE
KSILYLEGSALVFEDIFRLIAFYCVSRDLLPFTLRLPQAILEASSFTDLETIANLGLGFW
DSSLNPPQERGKPAEPPRDRAPGFPLVSSLRPTAHDANCACEIELSVGNDRLWFVNPIFI
EDCSSALPTDQPPLGNCPARPLPPTSDATSPTSRWAPRRPPPPPPVLPLQPCSPAQPPVL
PALAPAPACPLPTSPPVPAPHVTPHAPGPPDHPNQPPMMTCERLPCPTAGLGPLREEAMK
PGAASSPLQQVPAPPLPAKKNLPTAPPRRRVSERVSLEDQSPGMAAEGDQLSLPPQGTSD
GPEDTPRESTEQGQDTEVKASDPHSMPELPRTAKQPPVPPPRKKRISRQLASTLPAPLEN
AELCTQAMALETPTPGPPREGQSPASQAGTQHPPAQATAHSQSSPEFKGSLASLSDSLGV
SVMATDQDSYSTSSTEEELEQFSSPSVKKKPSMILGKARHRLSFASFSSMFHAFLSNNRK
LYKKVVELAQDKGSYFGSLVQDYKVYSLEMMARQTSSTEMLQEIRTMMTQLKSYLLQSTE
LKALVDPALHSEEELEAIVESALYKCVLKPLKEAINSCLHQIHSKDGSLQQLKENQLVIL
ATTTTDLGVTTSVPEVPMMEKILQKFTSMHKAYSPEKKISILLKTCKLIYDSMALGNPGK
PYGADDFLPVLMYVLARSNLTEMLLNVEYMMELMDPALQLGEGSYYLTTTYGALEHIKSY
DKITVTRQLSVEVQDSIHRWERRRTLNKARASRSSVQDFICVSYLEPEQQARTLASRADT
QAQALCAQCAEKFAVERPQAHRLFVLVDGRCFQLADDALPHCIKGYLLRSEPKRDFHFVY
RPLDGGGGGGGGSPPCLVVREPNFL
GenBank ID Protein 40353729
UniProtKB/Swiss-Prot ID Q8TB24
UniProtKB/Swiss-Prot Entry Name RIN3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_024832.3
GeneCard ID RIN3
GenAtlas ID RIN3
HGNC ID HGNC:18751
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121 ]
  4. Saito K, Murai J, Kajiho H, Kontani K, Kurosu H, Katada T: A novel binding protein composed of homophilic tetramer exhibits unique properties for the small GTPase Rab5. J Biol Chem. 2002 Feb 1;277(5):3412-8. Epub 2001 Dec 3. [PubMed:11733506 ]
  5. Kajiho H, Saito K, Tsujita K, Kontani K, Araki Y, Kurosu H, Katada T: RIN3: a novel Rab5 GEF interacting with amphiphysin II involved in the early endocytic pathway. J Cell Sci. 2003 Oct 15;116(Pt 20):4159-68. [PubMed:12972505 ]
  6. Yoshikawa M, Kajiho H, Sakurai K, Minoda T, Nakagawa S, Kontani K, Katada T: Tyr-phosphorylation signals translocate RIN3, the small GTPase Rab5-GEF, to early endocytic vesicles. Biochem Biophys Res Commun. 2008 Jul 18;372(1):168-72. doi: 10.1016/j.bbrc.2008.05.027. Epub 2008 May 16. [PubMed:18486601 ]