You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08559
Secondary Accession Numbers
  • 14273
Name GTP-binding protein Rit1
Synonyms
  1. Ras-like protein expressed in many tissues
  2. Ras-like without CAAX protein 1
Gene Name RIT1
Protein Type Unknown
Biological Properties
General Function Involved in GTP binding
Specific Function Plays a crucial role in coupling NGF stimulation to the activation of both EPHB2 and MAPK14 signaling pathways and in NGF- dependent neuronal differentiation
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
intracellular
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
gtpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signal transduction
small gtpase mediated signal transduction
Cellular Location
  1. Cell membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 1q22
SNPs RIT1
Gene Sequence
>660 bp
ATGGATTCTGGAACTCGCCCAGTTGGTAGCTGCTGTAGCAGCCCCGCTGGGCTCTCACGG
GAGTACAAACTAGTGATGCTGGGTGCTGGTGGTGTAGGGAAGAGTGCCATGACCATGCAG
TTCATCAGCCACCGATTCCCAGAAGATCATGATCCCACCATTGAAGATGCTTATAAGATC
AGGATCCGTATTGATGATGAGCCTGCCAATCTGGACATTTTGGATACAGCTGGACAGGCA
GAGTTTACAGCCATGCGGGACCAGTATATGAGGGCAGGAGAAGGGTTTATCATCTGTTAC
TCTATCACGGATCGTCGAAGTTTCCATGAAGTTCGAGAGTTTAAACAGCTTATTTATCGA
GTCCGACGTACTGACGATACACCTGTGGTTCTTGTGGGAAACAAGTCAGACCTCAAACAG
CTAAGACAGGTCACCAAGGAAGAAGGATTGGCCTTGGCCCGAGAATTCAGCTGTCCCTTT
TTTGAGACATCTGCTGCATACCGCTACTATATTGATGATGTTTTCCATGCCCTTGTACGG
GAGATACGTAGGAAAGAAAAGGAGGCAGTACTGGCCATGGAGAAAAAATCTAAGCCCAAA
AACAGTGTATGGAAGAGGCTAAAATCACCATTCCGGAAGAAGAAAGATTCAGTAACTTGA
Protein Properties
Number of Residues 219
Molecular Weight 25144.6
Theoretical pI 9.5
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>GTP-binding protein Rit1
MDSGTRPVGSCCSSPAGLSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKI
RIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFHEVREFKQLIYR
VRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVR
EIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT
GenBank ID Protein 4234918
UniProtKB/Swiss-Prot ID Q92963
UniProtKB/Swiss-Prot Entry Name RIT1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF084462
GeneCard ID RIT1
GenAtlas ID RIT1
HGNC ID HGNC:10023
References
General References
  1. Lee CH, Della NG, Chew CE, Zack DJ: Rin, a neuron-specific and calmodulin-binding small G-protein, and Rit define a novel subfamily of ras proteins. J Neurosci. 1996 Nov 1;16(21):6784-94. [PubMed:8824319 ]
  2. Wes PD, Yu M, Montell C: RIC, a calmodulin-binding Ras-like GTPase. EMBO J. 1996 Nov 1;15(21):5839-48. [PubMed:8918462 ]
  3. Shao H, Kadono-Okuda K, Finlin BS, Andres DA: Biochemical characterization of the Ras-related GTPases Rit and Rin. Arch Biochem Biophys. 1999 Nov 15;371(2):207-19. [PubMed:10545207 ]
  4. Shi GX, Andres DA: Rit contributes to nerve growth factor-induced neuronal differentiation via activation of B-Raf-extracellular signal-regulated kinase and p38 mitogen-activated protein kinase cascades. Mol Cell Biol. 2005 Jan;25(2):830-46. [PubMed:15632082 ]