Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08562
Secondary Accession Numbers
  • 14276
Name Phosphorylated adapter RNA export protein
Synonyms
  1. RNA U small nuclear RNA export adapter protein
Gene Name PHAX
Protein Type Unknown
Biological Properties
General Function Involved in RNA binding
Specific Function A phosphoprotein adapter involved in the XPO1-mediated U snRNA export from the nucleus. Bridge components required for U snRNA export, the cap binding complex (CBC)-bound snRNA on the one hand and the GTPase Ran in its active GTP-bound form together with the export receptor XPO1 on the other. Its phosphorylation in the nucleus is required for U snRNA export complex assembly and export, while its dephosphorylation in the cytoplasm causes export complex disassembly. It is recycled back to the nucleus via the importin alpha/beta heterodimeric import receptor. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Its compartmentalized phosphorylation cycle may also contribute to the directionality of export. Binds strongly to m7G-capped U1 and U5 small nuclear RNAs (snRNAs) in a sequence-unspecific manner and phosphorylation- independent manner. Plays also a role in the biogenesis of U3 small nucleolar RNA (snoRNA). Involved in the U3 snoRNA transport from nucleoplasm to Cajal bodies. Binds strongly to m7G-capped U3, U8 and U13 precursor snoRNAs and weakly to trimethylated (TMG)-capped U3, U8 and U13 snoRNAs. Binds also to telomerase RNA
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Nucleus
  2. Nucleus
  3. Cytoplasm
  4. nucleoplasm
  5. Cajal body
Gene Properties
Chromosome Location Chromosome:5
Locus 5q23.2
SNPs PHAX
Gene Sequence
>1185 bp
ATGGCGTTGGAGGTCGGCGATATGGAAGATGGGCAGCTTTCCGACTCGGATTCCGACATG
ACGGTCGCACCCAGCGACAGGCCGCTGCAATTGCCAAAAGTGCTAGGTGGCGACAGTGCT
ATGAGGGCCTTCCAGAACACGGCAACTGCATGTGCACCAGTATCACATTATCGAGCTGTT
GAAAGTGTGGATTCAAGTGAAGAAAGTTTTTCTGATTCAGATGATGATAGCTGTCTTTGG
AAACGCAAACGACAGAAATGTTTTAACCCTCCTCCCAAACCAGAGCCTTTTCAGTTTGGC
CAGAGCAGTCAGAAACCACCTGTTGCTGGAGGAAAGAAGATTAACAACATATGGGGTGCT
GTGCTGCAGGAACAGAATCAAGATGCAGTGGCCACTGAACTTGGTATCTTGGGAATGGAG
GCCACTATTGACAGAAGCAGACAATCCGAGACCTACAATTATTTGCTTGCCAAGAAACTT
AGGAAGGAATCTCAAGAGCATACAAAAGATCTAGACAAGGAACTAGATGAATATATGCAT
GGTGGCAAAAAAATGGGATCAAAGGAAGAGGAAAATGGGCAAGGTCATCTCAAAAGGAAA
CGACCTGTCAAAGACAGGCTAGGGAACAGACCAGAAATGAACTATAAAGGTCGATACGAG
ATCACAGCGGAAGATTCTCAAGAGAAAGTGGCTGATGAAATTTCATTCAGGTTACAGGAA
CCAAAGAAAGACCTGATAGCCCGAGTAGTGAGGATTATTGGTAACAAAAAGGCAATTGAA
CTTCTGATGGAAACCGCTGAAGTTGAACAAAATGGTGGTCTCTTTATAATGAATGGTAGT
CGAAGAAGAACACCAGGTGGAGTTTTTCTGAATCTCTTGAAAAACACTCCTAGTATCAGC
GAGGAACAAATTAAGGACATTTTCTACATTGAAAACCAAAAGGAATATGAAAATAAAAAA
GCTGCTAGGAAGAGGAGAACACAAGTGTTGGGGAAAAAGATGAAACAAGCTATTAAAAGT
CTAAATTTTCAAGAAGCTGATGATACATCACGAGAAACTTTTGCAAGTGACACGAATGAG
GCCTTGGCCTCTCTTGATGAGTCACAGGAAGGACATGCAGAAGCCAAGTTGGAGGCAGAG
GAAGCCATTGAAGTTGATCATTCTCATGATTTGGACATCTTTTAA
Protein Properties
Number of Residues 394
Molecular Weight 44402.2
Theoretical pI 5.05
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Phosphorylated adapter RNA export protein
MALEVGDMEDGQLSDSDSDMTVAPSDRPLQLPKVLGGDSAMRAFQNTATACAPVSHYRAV
ESVDSSEESFSDSDDDSCLWKRKRQKCFNPPPKPEPFQFGQSSQKPPVAGGKKINNIWGA
VLQEQNQDAVATELGILGMEGTIDRSRQSETYNYLLAKKLRKESQEHTKDLDKELDEYMH
GGKKMGSKEEENGQGHLKRKRPVKDRLGNRPEMNYKGRYEITAEDSQEKVADEISFRLQE
PKKDLIARVVRIIGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSIS
EEQIKDIFYIENQKEYENKKAARKRRTQVLGKKMKQAIKSLNFQEDDDTSRETFASDTNE
ALASLDESQEGHAEAKLEAEEAIEVDHSHDLDIF
GenBank ID Protein 10435105
UniProtKB/Swiss-Prot ID Q9H814
UniProtKB/Swiss-Prot Entry Name PHAX_HUMAN
PDB IDs Not Available
GenBank Gene ID AK023255
GeneCard ID PHAX
GenAtlas ID PHAX
HGNC ID HGNC:10241
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  5. Boulon S, Verheggen C, Jady BE, Girard C, Pescia C, Paul C, Ospina JK, Kiss T, Matera AG, Bordonne R, Bertrand E: PHAX and CRM1 are required sequentially to transport U3 snoRNA to nucleoli. Mol Cell. 2004 Dec 3;16(5):777-87. [PubMed:15574332 ]
  6. Segref A, Mattaj IW, Ohno M: The evolutionarily conserved region of the U snRNA export mediator PHAX is a novel RNA-binding domain that is essential for U snRNA export. RNA. 2001 Mar;7(3):351-60. [PubMed:11333016 ]
  7. Watkins NJ, Lemm I, Ingelfinger D, Schneider C, Hossbach M, Urlaub H, Luhrmann R: Assembly and maturation of the U3 snoRNP in the nucleoplasm in a large dynamic multiprotein complex. Mol Cell. 2004 Dec 3;16(5):789-98. [PubMed:15574333 ]