You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08570
Secondary Accession Numbers
  • 14284
Name Rhotekin
Synonyms Not Available
Gene Name RTKN
Protein Type Unknown
Biological Properties
General Function Involved in signal transduction
Specific Function Mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. May play a novel role in the organization of septin structures
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:2
Locus 2p13.1
SNPs RTKN
Gene Sequence
>1692 bp
ATGTTCTCCCGAAACCACCGGAGCCGGGTCACCGTGGCCAGGGGCTCCGCCCTGGAGATG
GAGTTCAAACGCGGCCGCTTCCGACTCAGCCTCTTCAGCGACCTGCCCGAGGACACGGAG
TTGCAGAGGAAGCTAGACCATGAGATCCGGATGAGGGAAGGGGCCTGTAAGCTGCTGGCA
GCCTGCTCCCAGCGAGAGCAGGCTCTGGAGGCCACCAAGAGCCTGCTAGTGTGCAACAGC
CGCATCCTCAGCTACATGGGCGAGCTGCAGCGGCGCAAGGAGGCGCAGGTGCTGGGGAAG
ACAAGCCGGCGGCCTTCTGACAGTGGCCCGCCCGCTGAGCGCTCCCCCTGCCGCGGCCGG
GTCTGCATCTCTGACCTCCGGATTCCACTCATGTGGAAGGACACAGAATATTTCAAGAAC
AAAGGTGACTTGCACCGCTGGGCTGTGTTCCTGCTGCTGCAGCTGGGGGAACACATCCAG
GACACAGAGATGATCCTAGTGGACAGGACCCTCACAGACATCTCCTTTCAGAGCAATGTG
CTCTTCGCTGAGGCGGGGCCAGACTTTGAACTGCGGTTAGAGCTGTATGGGGCCTGTGTG
GAAGAAGAGGGGGCCCTGACTGGCGGCCCCAAGAGGCTTGCCACCAAACTCAGCAGCTCC
CTGGGCCGCTCCTCAGGGAGGCGTGTCCGGGCATCGCTGGACAGTGCTGGGGGTTCAGGG
AGCAGTCCCATCTTGCTCCCCACCCCAGTTGTTGGTGGTCCTCGTTACCACCTCTTGGCT
CACACCACACTCACCCTGGCAGCAGTGCAAGATGGATTCCGCACACATGACCTCACCCTT
GCCAGTCATGAGGAGAACCCTGCCTGGCTGCCCCTTTATGGTAGCGTGTGTTGCCGTCTG
GCAGCTCAGCCTCTCTGCATGACTCAGCCCACTGCAAGTGGTACCCTCAGGGTGCAGCAA
GCTGGGGAGATGCAGAACTGGGCACAAGTGCATGGAGTTCTGAAAGGCACAAACCTCTTC
TGTTACCGGCAACCTGAGGATGCAGACACTGGGGAAGAGCCGCTGCTTACTATTGCTGTC
AACAAGGAGACTCGAGTCCGGGCAGGGGAGCTGGACCAGGCTCTAGGACGGCCCTTCACC
CTAAGCATCAGTAACCAGTATGGGGATGATGAGGTGACACACACCCTTCAGACAGAAAGT
CGGGAAGCACTGCAGAGCTGGATGGAGGCTCTGTGGCAGCTTTTCTTTGACATGAGCCAA
TGGAAGCAGTGCTGTGATGAAATCATGAAAATTGAAACTCCTGCTCCCCGGAAACCACCC
CAAGCACTGGCAAAGCAGGGGTCCTTGTACCATGAGATGGCTATTGAGCCGCTGGATGAC
ATCGCAGCGGTGACAGACATCCTGACCCAGCGGGAGGGCGCAAGGCTGGAGACACCCCCA
CCCTGGCTGGCAATGTTTACAGACCAGCCTGCCCTGCCTAACCCCTGCTCGCCTGCCTCA
GTGGCCCCAGCCCCAGACTGGACCCACCCCCTGCCCTGGGGGAGACCCCGAACCTTTTCC
CTGGATGCTGTCCCCCCAGACCACTCCCCTAGGGCTCGCTCGGTTGCCCCCCTCCCACCT
CAGCGATCCCCACGGACCAGAGGCCTCTGCAGCAAAGGCCAACCTCGCACTTGGCTCCAG
TCACCAGTGTGA
Protein Properties
Number of Residues 563
Molecular Weight 62666.8
Theoretical pI 7.47
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rhotekin
MFSRNHRSRVTVARGSALEMEFKRGRFRLSLFSDLPEDTELQRKLDHEIRMREGACKLLA
ACSQREQALEATKSLLVCNSRILSYMGELQRRKEAQVLGKTSRRPSDSGPPAERSPCRGR
VCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLGEHIQDTEMILVDRTLTDISFQSNV
LFAEAGPDFELRLELYGACVEEEGALTGGPKRLATKLSSSLGRSSGRRVRASLDSAGGSG
SSPILLPTPVVGGPRYHLLAHTTLTLAAVQDGFRTHDLTLASHEENPAWLPLYGSVCCRL
AAQPLCMTQPTASGTLRVQQAGEMQNWAQVHGVLKGTNLFCYRQPEDADTGEEPLLTIAV
NKETRVRAGELDQALGRPFTLSISNQYGDDEVTHTLQTESREALQSWMEALWQLFFDMSQ
WKQCCDEIMKIETPAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQREGARLETPP
PWLAMFTDQPALPNPCSPASVAPAPDWTHPLPWGRPRTFSLDAVPPDHSPRARSVAPLPP
QRSPRTRGLCSKGQPRTWLQSPV
GenBank ID Protein 62739179
UniProtKB/Swiss-Prot ID Q9BST9
UniProtKB/Swiss-Prot Entry Name RTKN_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001015055.1
GeneCard ID RTKN
GenAtlas ID RTKN
HGNC ID HGNC:10466
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Reynaud C, Fabre S, Jalinot P: The PDZ protein TIP-1 interacts with the Rho effector rhotekin and is involved in Rho signaling to the serum response element. J Biol Chem. 2000 Oct 27;275(43):33962-8. [PubMed:10940294 ]
  5. Fu Q, Yu L, Liu Q, Zhang J, Zhang H, Zhao S: Molecular cloning, expression characterization, and mapping of a novel putative inhibitor of rho GTPase activity, RTKN, to D2S145-D2S286. Genomics. 2000 Jun 15;66(3):328-32. [PubMed:10873388 ]
  6. Liu CA, Wang MJ, Chi CW, Wu CW, Chen JY: Rho/Rhotekin-mediated NF-kappaB activation confers resistance to apoptosis. Oncogene. 2004 Nov 18;23(54):8731-42. [PubMed:15480428 ]
  7. Ito H, Iwamoto I, Morishita R, Nozawa Y, Narumiya S, Asano T, Nagata K: Possible role of Rho/Rhotekin signaling in mammalian septin organization. Oncogene. 2005 Oct 27;24(47):7064-72. [PubMed:16007136 ]