You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08571
Secondary Accession Numbers
  • 14285
Name RUN and FYVE domain-containing protein 1
Synonyms
  1. FYVE-finger protein EIP1
  2. La-binding protein 1
  3. Rab4-interacting protein
  4. Zinc finger FYVE domain-containing protein 12
Gene Name RUFY1
Protein Type Unknown
Biological Properties
General Function Involved in zinc ion binding
Specific Function Binds phospholipid vesicles containing phosphatidylinositol 3-phosphate and participates in early endosomal trafficking
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
protein binding
Cellular Location
  1. Cytoplasm
  2. Peripheral membrane protein
  3. Early endosome membrane
Gene Properties
Chromosome Location Chromosome:5
Locus 5q35.3
SNPs RUFY1
Gene Sequence
>2127 bp
ATGGCCGACCGGGAAGGCGGCTGCGCTGCTGGGCGGGGGCGGGAGCTGGAGCCGGAGCTG
GAGCCGGGGCCGGGGCCCGGGTCAGCGCTTGAGCCGGGAGAAGAGTTTGAGATCGTGGAC
CGAAGCCAGCTGCCCGGCCCAGGCGACCTGCGGAGCGCAACGAGGCCGCGGGCGGCCGAG
GGCTGGTCGGCGCCCATCCTGACCCTGGCACGCAGGGCCACCGGGAACCTGTCGGCGAGC
TGCGGGAGCGCGCTGCGCGCGGCCGCGGGGCTGGGCGGCGGGGACAGCGGGGACGGCACG
GCGCGCGCAGCTTCTAAGTGCCAGATGATGGAGGAGCGTGCCAACCTGATGCACATGATG
AAACTCAGCATCAAGGTGTTGCTCCAGTCGGCTCTGAGCCTGGGCCGCAGCCTGGATGCG
GACCATGCCCCCTTGCAGCAGTTCTTTGTAGTGATGGAGCACTGCCTCAAACATGGGCTG
AAAGTTAAGAAGAGTTTTATTGGCCAAAATAAATCATTCTTTGGTCCTTTGGAGCTGGTG
GAGAAACTTTGTCCAGAAGCATCAGATATAGCGACTAGTGTCAGAAATCTTCCAGAATTA
AAGACAGCTGTGGGAAGAGGCCGAGCGTGGCTTTATCTTGCACTCATGCAAAAGAAACTG
GCAGATTATCTGAAAGTGCTTATAGACAATAAACATCTCTTAAGCGAGTTCTATGAGCCT
GAGGCTTTAATGATGGAGGAAGAAGGGATGGTGATTGTTGGTCTGCTGGTGGGACTCAAT
GTTCTCGATGCCAATCTCTGCTTGAAAGGAGAAGACTTGGATTCTCAGGTTGGAGTAATA
GATTTTTCCCTCTACCTTAAGGATGTGCAGGATCTTGATGGTGGCAAGGAGCATGAAAGA
ATTACTGATGTCCTTGATCAAAAAAATTATGTGGAAGAACTTAACCGGCACTTGAGCTGC
ACAGTTGGGGATCTTCAAACCAAGATAGATGGCTTGGAAAAGACTAACTCAAAGCTTCAA
GAAGAGCTTTCAGCTGCAACAGACCGAATTTGCTCACTTCAAGAAGAACAGCAGCAGTTA
AGAGAACAAAATGAATTAATTCGAGAAAGAAGTGAAAAGAGTGTAGAGATAACAAAACAG
GATACCAAAGTTGAGCTGGAGACTTACAAGCAAACTCGGCAAGGTCTGGATGAAATGTAC
AGTGATGTGTGGAAGCAGCTAAAAGAGGAGAAGAAAGTCCGGTTGGAACTGGAAAAAGAA
CTGGAGTTACAAATTGGAATGAAAACCGAAATGGAAATTGCAATGAAGTTACTGGAAAAG
GACACCCACGAGAAGCAGGACACACTAGTTGCCCTCCGCCAGCAGCTGGAAGAAGTCAAA
GCGATTAATTTACAGATGTTTCACAAAGCTCAGAATGCAGAGAGCAGTTTGCAGCAGAAG
AATGAAGCCATCACATCCTTTGAAGGAAAAACCAACCAAGTTATGTCCAGCATGAAACAA
ATGGAAGAAAGGTTGCAGCACTCGGAGCGGGCGAGGCAGGGGGCTGAGGAGCGGAGCCAC
AAGCTGCAGCAGGAGCTGGGCGGGAGGATCGGCGCCCTGCAGCTGCAGCTCTCCCAGCTG
CACGAGCAATGCTCAAGCCTGGAGAAAGAATTGAAATCAGAAAAAGAGCAAAGACAGGCT
CTTCAGCGCGAATTACAGCACGAGAAAGACACTTCCTCTCTACTCAGGATGGAGCTGCAA
CAAGTGGAAGGACTGAAAAAGGAGTTGCGGGAGCTTCAGGACGAGAAGGCAGAGCTGCAG
AAGATCTGCGAGGAGCAGGAACAAGCCCTCCAGGAAATGGGCCTGCACCTCAGCCAGTCC
AAGCTGAAGATGGAAGATATAAAAGAAGTGAACCAGGCACTGAAGGGCCACGCCTGGCTG
AAAGATGACGAAGCGACACACTGTAGGCAGTGTGAGAAGGAGTTCTCCATTTCCCGGAGA
AAGCACCACTGCCGGAACTGTGGCCACATCTTCTGCAACACCTGCTCCAGCAACGAGCTG
GCCCTGCCCTCCTACCCCAAGCCGGTGCGAGTGTGCGACAGCTGCCACACCCTGCTCCTG
CAGCGCTGCTCCTCCACGGCCTCCTGA
Protein Properties
Number of Residues 708
Molecular Weight 79817.2
Theoretical pI 5.52
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>RUN and FYVE domain-containing protein 1
MADREGGCAAGRGRELEPELEPGPGPGSALEPGEEFEIVDRSQLPGPGDLRSATRPRAAE
GWSAPILTLARRATGNLSASCGSALRAAAGLGGGDSGDGTARAASKCQMMEERANLMHMM
KLSIKVLLQSALSLGRSLDADHAPLQQFFVVMEHCLKHGLKVKKSFIGQNKSFFGPLELV
EKLCPEASDIATSVRNLPELKTAVGRGRAWLYLALMQKKLADYLKVLIDNKHLLSEFYEP
EALMMEEEGMVIVGLLVGLNVLDANLCLKGEDLDSQVGVIDFSLYLKDVQDLDGGKEHER
ITDVLDQKNYVEELNRHLSCTVGDLQTKIDGLEKTNSKLQEELSAATDRICSLQEEQQQL
REQNELIRERSEKSVEITKQDTKVELETYKQTRQGLDEMYSDVWKQLKEEKKVRLELEKE
LELQIGMKTEMEIAMKLLEKDTHEKQDTLVALRQQLEEVKAINLQMFHKAQNAESSLQQK
NEAITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQL
HEQCSSLEKELKSEKEQRQALQRELQHEKDTSSLLRMELQQVEGLKKELRELQDEKAELQ
KICEEQEQALQEMGLHLSQSKLKMEDIKEVNQALKGHAWLKDDEATHCRQCEKEFSISRR
KHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLLQRCSSTAS
GenBank ID Protein 94721336
UniProtKB/Swiss-Prot ID Q96T51
UniProtKB/Swiss-Prot Entry Name RUFY1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_025158.3
GeneCard ID RUFY1
GenAtlas ID RUFY1
HGNC ID HGNC:19760
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  4. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  5. Yang J, Kim O, Wu J, Qiu Y: Interaction between tyrosine kinase Etk and a RUN domain- and FYVE domain-containing protein RUFY1. A possible role of ETK in regulation of vesicle trafficking. J Biol Chem. 2002 Aug 16;277(33):30219-26. Epub 2002 Mar 4. [PubMed:11877430 ]
  6. Fouraux MA, Deneka M, Ivan V, van der Heijden A, Raymackers J, van Suylekom D, van Venrooij WJ, van der Sluijs P, Pruijn GJ: Rabip4' is an effector of rab5 and rab4 and regulates transport through early endosomes. Mol Biol Cell. 2004 Feb;15(2):611-24. Epub 2003 Nov 14. [PubMed:14617813 ]