Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08576
Secondary Accession Numbers
  • 14290
Name Sterol regulatory element-binding protein cleavage-activating protein
Synonyms
  1. SCAP
  2. SREBP cleavage-activating protein
Gene Name SCAP
Protein Type Unknown
Biological Properties
General Function Involved in unfolded protein binding
Specific Function Escort protein required for cholesterol as well as lipid homeostasis. Regulates export of the SCAP/SREBF complex from the ER upon low cholesterol. Formation of a ternary complex with INSIG at high sterol concentrations leads to masking of an ER-export signal in SCAP and retention of the complex in the ER. Low sterol concentrations trigger release of INSIG, a conformational change in the SSC domain of SCAP, unmasking of the ER export signal, recruitment into COPII-coated vesicles, transport to the Golgi complex, proteolytic cleavage of SREBF in the Golgi, release of the transcription factor fragment of SREBF from the membrane, its import into the nucleus and up-regulation of LDLR, INSIG1 and the mevalonate pathway
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Cellular Location
  1. Golgi apparatus membrane
  2. Cytoplasmic vesicle
  3. Endoplasmic reticulum membrane
  4. Multi-pass membrane protein
  5. Multi-pass membrane protein
  6. Multi- pass membrane protein
  7. COPII- coated vesicle membrane
Gene Properties
Chromosome Location Chromosome:3
Locus 3p21.31
SNPs SCAP
Gene Sequence
>3840 bp
ATGACCCTGACTGAAAGGCTGCGTGAGAAGATATCTCGGGCCTTCTACAACCATGGGCTC
CTCTGTGCATCCTATCCCATCCCCATCATCCTCTTCACAGGGTTCTGCATCTTAGCCTGC
TGCTACCCACTGCTGAAACTCCCCTTGCCAGGAACAGGACCTGTGGAATTCACCACCCCT
GTGAAGGATTACTCGCCCCCACCTGTGGACTCTGACCGCAAACAAGGAGAGCCTACTGAG
CAGCCTGAGTGGTATGTGGGTGCCCCGGTGGCTTATGTCCAGCAGATATTTGTGAAGTCC
TCAGTGTTTCCCTGGCACAAGAACCTCCTGGCAGTAGATGTATTTCGTTCACCTTTGTCC
CGGGCATTCCAACTGGTGGAGGAGATCCGGAACCACGTGCTGAGAGACAGCTCTGGGATC
AGGAGCTTGGAGGAGTTGTGTCTGCAAGTGACCGACCTGCTGCCAGGCCTTAGGAAGCTC
AGGAACCTACTCCCTGAGCATGGATGCCTGCTGCTGTCCCCTGGGAACTTCTGGCAGAAT
GACTGGGAACGCTTCCATGCTGATCCTGACATCATTGGGACCATCCACCAGCACGAGCCT
AAAACCCTGCAGACTTCAGCCACACTCAAAGACTTGTTATTTGGTGTTCCTGGGAAGTAC
AGCGGGGTGAGCCTCTACACCAGGAAGAGGATGGTCTCCTACACCATCACCCTGGTCTTC
CAGCACTACCATGCCAAGTTCCTGGGCAGCCTGCGTGCCCGCCTGATGCTTCTGCACCCC
AGCCCCAACTGCAGCCTTCGGGCGGAGAGCCTGGTCCACGTGCACTTCAAGGAGGAGATT
GGTGTCGCTGAGCTCATCCCCCTTGTGACCACCTACATCATCTTGTTTGCCTACATCTAC
TTCTCCACGCGGAAGATCGACATGGTCAAGTCCAAGTGGGGGCTGGCCCTGGCTGCCGTG
GTCACAGTGCTCAGCTCGCTGCTCATGTCTGTGGGACTCTGCACACTCTTCGGCCTGACG
CCCACCCTCAATGGCGGCGAGATTTTCCCCTACCTTGTGGTGGTTATTGGGTTAGAGAAT
GTGTTGGTGCTCACCAAGTCTGTGGTCTCAACCCCGGTAGACCTGGAGGTGAAGCTGCGG
ATCGCCCAAGGCCTAAGCAGCGAGAGCTGGTCCATCATGAAGAACATGGCCACGGAGCTG
GGCATCATCCTCATCGGCTACTTCACCCTAGTGCCCGCCATCCAGGAGTTCTGTCTCTTT
GCTGTCGTGGGGCTGGTGTCTGACTTCTTCCTTCAGATGCTGTTTTTCACCACTGTCCTG
TCCATTGACATTCGCCGGATGGAGCTAGCAGACCTGAACAAGCGACTGCCCCCTGAGGCC
TGCCTGCCCTCAGCCAAGCCAGTGGGACAGCCAACGCGCTACGAGCGGCAGCTGGCTGTG
AGGCCGTCCACACCCCACACCATCACGTTGCAGCCGTCTTCCTTCCGAAACCTGCGGCTC
CCCAAGAGGCTGCGTGTTGTCTACTTCCTGGCCCGCACCCGCCTGGCACAGCGCCTCATC
ATGGCTGGCACCGTTGTCTGGATTGGCATCCTGGTATACACAGACCCAGCAGGGCTGCGC
AACTACCTCGCTGCCCAGGTGACGGAACAGAGCCCATTGGGTGAGGGAGCCCTGGCTCCC
ATGCCCGTGCCTAGTGGCATGCTGCCCCCCAGCCACCCGGACCCTGCCTTCTCCATCTTC
CCACCTGATGCCCCTAAGCTACCTGAGAACCAGACGTCGCCAGGCGAGTCACCTGAGCGT
GGAGGTCCAGCAGAGGTTGTCCATGACAGCCCAGTCCCAGAGGTAACCTGGGGGCCTGAG
GATGAGGAACTTTGGAGGAAATTGTCCTTCCGCCACTGGCCGACGCTCTTCAGCTATTAC
AACATCACACTGGCCAAGAGGTACATCAGCCTGCTGCCCGTCATCCCAGTCACGCTCCGC
CTGAACCCGAGGGAGGCTCTGGAGGGCCGGCACCCTCAGGACGGCCGCAGTGCCTGGCCC
CCACCGGGGCCCATACCTGCTGGGCACTGGGAAGCAGGACCCAAGGGCCCAGGTGGGGTG
CAGGCCCATGGAGACGTCACGCTGTACAAGGTGGCGGCGCTGGGCCTGGCCACCGGCATC
GTCTTGGTGCTGCTGCTGCTCTGCCTCTACCGCGTGCTATGCCCGCGCAACTACGGGCAG
CTGGGTGGTGGGCCCGGGCGGCGGAGGCGCGGGGAGCTGCCCTGCGACGACTACGGCTAT
GCGCCACCCGAGACGGAGATCGTGCCGCTTGTGCTGCGCGGCCACCTCATGGACATCGAG
TGCCTGGCCAGCGACGGCATGCTGCTGGTGAGCTGCTGCCTGGCAGGCCACGTCTGCGTG
TGGGACGCGCAGACCGGGGATTGCCTAACGCGCATTCCGCGCCCAGGCAGGCAGCGCCGG
GACAGTGGCGTGGGCAGCGGGCTTGAGGCTCAGGAGAGCTGGGAACGACTTTCAGATGGT
GGGAAGGCTGGTCCAGAGGAGCCTGGGGACAGCCCTCCCCTGAGACACCGCCCCCGGGGC
CCTCCGCCGCCTTCCCTCTTCGGGGACCAGCCTGACCTCACCTGCTTAATTGACACCAAC
TTTTCAGCGCAGCCTCGGTCCTCACAGCCCACTCAGCCCGAGCCCCGGCACCGGGCGGTC
TGTGGCCGCTCTCGGGACTCCCCAGGCTATGACTTCAGCTGCCTGGTGCAGCGGGTGTAC
CAGGAGGAGGGGCTGGCGGCCGTCTGCACACCAGCCCTGCGCCCACCCTCGCCTGGGCCG
GTGCTGTCCCAGGCCCCTGAGGACGAGGGTGGCTCCCCCGAGAAAGGCTCCCCTTCCCTC
GCCTGGGCCCCCAGTGCCGAGGGTTCCATCTGGAGCTTGGAGCTGCAGGGCAACCTCATC
GTGGTGGGGCGGAGCAGCGGCCGGCTGGAGGTGTGGGACGCCATTGAAGGGGTGCTGTGC
TGCAGCAGCGAGGAGGTCTCCTCAGGCATTACCGCTCTGGTGTTCTTGGACAAAAGGATT
GTGGCTGCACGGCTCAACGGTTCCCTTGATTTCTTCTCCTTGGAGACCCACACTGCCCTC
AGCCCCCTGCAGTTTAGAGGGACCCCAGGGCGGGGCAGTTCCCCTGCCTCTCCAGTGTAC
AGCAGCAGCGACACAGTGGCCTGTCACCTGACCCACACAGTGCCCTGTGCACACCAAAAA
CCCATCACAGCCCTGAAAGCCGCTGCTGGGCGCTTGGTGACTGGGAGCCAAGACCACACA
CTGAGAGTGTTCCGTCTGGAGGACTCGTGCTGCCTCTTCACCCTTCAGGGCCACTCAGGG
GCCATCACGACCGTGTACATTGACCAGACCATGGTGCTGGCCAGTGGAGGACAAGATGGG
GCCATCTGCCTGTGGGATGTACTGACTGGCAGCCGGGTCAGCCATGTGTTTGCTCACCGT
GGGGATGTCACCTCCCTTACCTGTACCACCTCCTGTGTCATCAGCAGTGGCCTGGATGAC
CTCATCAGCATCTGGGACCGCAGCACAGGCATCAAGTTCTACTCCATTCAGCAGGACCTG
GGCTGTGGTGCAAGCTTGGGTGTCATCTCAGACAACCTGCTGGTGACTGGCGGCCAGGGC
TGTGTCTCCTTTTGGGACCTAAACTACGGGGACCTGTTACAGACAGTCTACCTGGGGAAG
AACAGTGAGGCCCAGCCTGCCCGCCAGATCCTGGTGCTGGACAACGCTGCCATTGTCTGC
AACTTTGGCAGTGAGCTCAGCCTGGTGTATGTGCCCTCTGTGCTGGAGAAGCTGGACTGA
Protein Properties
Number of Residues 1279
Molecular Weight 139727.6
Theoretical pI 6.85
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 19-39
  • 280-300
  • 313-333
  • 345-365
  • 402-422
  • 424-444
  • 519-539
  • 710-730
Protein Sequence
>Sterol regulatory element-binding protein cleavage-activating protein
MTLTERLREKISRAFYNHGLLCASYPIPIILFTGFCILACCYPLLKLPLPGTGPVEFTTP
VKDYSPPPVDSDRKQGEPTEQPEWYVGAPVAYVQQIFVKSSVFPWHKNLLAVDVFRSPLS
RAFQLVEEIRNHVLRDSSGIRSLEELCLQVTDLLPGLRKLRNLLPEHGCLLLSPGNFWQN
DWERFHADPDIIGTIHQHEPKTLQTSATLKDLLFGVPGKYSGVSLYTRKRMVSYTITLVF
QHYHAKFLGSLRARLMLLHPSPNCSLRAESLVHVHFKEEIGVAELIPLVTTYIILFAYIY
FSTRKIDMVKSKWGLALAAVVTVLSSLLMSVGLCTLFGLTPTLNGGEIFPYLVVVIGLEN
VLVLTKSVVSTPVDLEVKLRIAQGLSSESWSIMKNMATELGIILIGYFTLVPAIQEFCLF
AVVGLVSDFFLQMLFFTTVLSIDIRRMELADLNKRLPPEACLPSAKPVGQPTRYERQLAV
RPSTPHTITLQPSSFRNLRLPKRLRVVYFLARTRLAQRLIMAGTVVWIGILVYTDPAGLR
NYLAAQVTEQSPLGEGALAPMPVPSGMLPPSHPDPAFSIFPPDAPKLPENQTSPGESPER
GGPAEVVHDSPVPEVTWGPEDEELWRKLSFRHWPTLFSYYNITLAKRYISLLPVIPVTLR
LNPREALEGRHPQDGRSAWPPPGPIPAGHWEAGPKGPGGVQAHGDVTLYKVAALGLATGI
VLVLLLLCLYRVLCPRNYGQLGGGPGRRRRGELPCDDYGYAPPETEIVPLVLRGHLMDIE
CLASDGMLLVSCCLAGHVCVWDAQTGDCLTRIPRPGRQRRDSGVGSGLEAQESWERLSDG
GKAGPEEPGDSPPLRHRPRGPPPPSLFGDQPDLTCLIDTNFSAQPRSSQPTQPEPRHRAV
CGRSRDSPGYDFSCLVQRVYQEEGLAAVCTPALRPPSPGPVLSQAPEDEGGSPEKGSPSL
AWAPSAEGSIWSLELQGNLIVVGRSSGRLEVWDAIEGVLCCSSEEVSSGITALVFLDKRI
VAARLNGSLDFFSLETHTALSPLQFRGTPGRGSSPASPVYSSSDTVACHLTHTVPCAHQK
PITALKAAAGRLVTGSQDHTLRVFRLEDSCCLFTLQGHSGAITTVYIDQTMVLASGGQDG
AICLWDVLTGSRVSHVFAHRGDVTSLTCTTSCVISSGLDDLISIWDRSTGIKFYSIQQDL
GCGASLGVISDNLLVTGGQGCVSFWDLNYGDLLQTVYLGKNSEAQPARQILVLDNAAIVC
NFGSELSLVYVPSVLEKLD
GenBank ID Protein 66932902
UniProtKB/Swiss-Prot ID Q12770
UniProtKB/Swiss-Prot Entry Name SCAP_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_012235.2
GeneCard ID SCAP
GenAtlas ID SCAP
HGNC ID HGNC:30634
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  5. Wang Y, Du D, Fang L, Yang G, Zhang C, Zeng R, Ullrich A, Lottspeich F, Chen Z: Tyrosine phosphorylated Par3 regulates epithelial tight junction assembly promoted by EGFR signaling. EMBO J. 2006 Nov 1;25(21):5058-70. Epub 2006 Oct 19. [PubMed:17053785 ]
  6. Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T: Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. DNA Res. 2005;12(2):117-26. [PubMed:16303743 ]
  7. Nagase T, Seki N, Ishikawa K, Tanaka A, Nomura N: Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1. DNA Res. 1996 Feb 29;3(1):17-24. [PubMed:8724849 ]
  8. Nakajima T, Hamakubo T, Kodama T, Inazawa J, Emi M: Genomic structure and chromosomal mapping of the human sterol regulatory element binding protein (SREBP) cleavage-activating protein (SCAP) gene. J Hum Genet. 1999;44(6):402-7. [PubMed:10570913 ]
  9. Heemers H, Verrijdt G, Organe S, Claessens F, Heyns W, Verhoeven G, Swinnen JV: Identification of an androgen response element in intron 8 of the sterol regulatory element-binding protein cleavage-activating protein gene allowing direct regulation by the androgen receptor. J Biol Chem. 2004 Jul 16;279(29):30880-7. Epub 2004 May 6. [PubMed:15133039 ]
  10. Irisawa M, Inoue J, Ozawa N, Mori K, Sato R: The sterol-sensing endoplasmic reticulum (ER) membrane protein TRC8 hampers ER to Golgi transport of sterol regulatory element-binding protein-2 (SREBP-2)/SREBP cleavage-activated protein and reduces SREBP-2 cleavage. J Biol Chem. 2009 Oct 16;284(42):28995-9004. doi: 10.1074/jbc.M109.041376. Epub 2009 Aug 25. [PubMed:19706601 ]
  11. Iwaki K, Nakajima T, Ota N, Emi M: A common Ile796Val polymorphism of the human SREBP cleavage-activating protein (SCAP) gene. J Hum Genet. 1999;44(6):421-2. [PubMed:10570919 ]