You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08585
Secondary Accession Numbers
  • 14300
Name Signal recognition particle 54 kDa protein
Synonyms
  1. SRP54
Gene Name SRP54
Protein Type Unknown
Biological Properties
General Function Involved in nucleotide binding
Specific Function Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein)
Pathways Not Available
Reactions Not Available
GO Classification
Component
macromolecular complex
signal recognition particle
ribonucleoprotein complex
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
protein binding
nucleic acid binding
7s rna binding
nucleoside-triphosphatase activity
rna binding
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Process
protein targeting to membrane
cotranslational protein targeting to membrane
establishment of localization
transport
protein transport
srp-dependent cotranslational protein targeting to membrane
intracellular protein transport
protein targeting
Cellular Location
  1. Cytoplasm
  2. Nucleus speckle
Gene Properties
Chromosome Location Chromosome:1
Locus 14q13.2
SNPs SRP54
Gene Sequence
>1515 bp
ATGGTTCTAGCAGACCTTGGAAGAAAAATAACATCAGCATTACGCTCGTTGAGCAATGCC
ACCATTATCAATGAAGAGGTATTGAATGCTATGCTAAAAGAAGTCTGTACCGCTTTGTTG
GAAGCAGATGTTAATATTAAACTAGTGAAGCAACTAAGAGAAAATGTTAAGTCTGCTATT
GATCTTGAAGAGATGGCATCTGGTCTTAACAAAAGAAAAATGATTCAGCATGCTGTATTT
AAAGAACTTGTGAAGCTTGTAGACCCTGGAGTTAAGGCATGGACACCCACTAAAGGAAAA
CAAAATGTGATTATGTTTGTTGGATTGCAAGGGAGTGGTAAAACAACAACATGTTCAAAG
CTAGCATATTATTACCAGAGGAAAGGTTGGAAGACCTGTTTAATATGTGCAGACACATTC
AGAGCAGGGGCTTTTGACCAACTAAAACAGAATGCTACCAAAGCAAGAATTCCATTTTAT
GGAAGCTATACAGAAATGGATCCTGTCATCATTGCTTCTGAAGGAGTAGAGAAATTTAAA
AATGAAAATTTTGAAATTATTATTGTTGATACAAGTGGCCGCCACAAACAAGAAGACTCT
TTGTTTGAAGAAATGCTTCAAGTTGCTAATGCTATACAACCTGATAACATTGTTTATGTG
ATGGATGCCTCCATTGGGCAGGCTTGTGAAGCCCAGGCTAAGGCTTTTAAAGATAAAGTA
GATGTAGCCTCAGTAATAGTGACAAAACTTGATGGCCATGCAAAAGGAGGTGGTGCACTC
AGTGCAGTCGCTGCCACAAAAAGTCCAATTATTTTCATTGGTACAGGGGAACATATAGAT
GACTTTGAACCTTTCAAAACACAGCCTTTTATTAGCAAACTTCTTGGTATGGGCGACATT
GAAGGACTGATAGATAAAGTCAACGAGTTGAAGTTGGATGACAATGAAGCACTTATAGAG
AAGTTGAAACATGGTCAGTTTACGTTGCGAGACATGTATGAGCAATTTCAAAATATCATG
AAAATGGGCCCCTTCAGTCAGATCTTGGGGATGATCCCTGGTTTTGGGACAGATTTTATG
AGCAAAGGAAATGAACAGGAGTCAATGGCAAGGCTAAAGAAATTAATGACAATAATGGAT
AGTATGAATGATCAAGAACTAGACAGTACGGATGGTGCCAAAGTTTTTAGTAAACAACCA
GGAAGAATCCAAAGAGTAGCAAGAGGATCGGGTGTATCAACAAGAGATGTTCAAGAACTT
TTGACACAATATACCAAGTTTGCACAGATGGTAAAAAAGATGGGAGGTATCAAAGGACTT
TTCAAAGGTGGCGACATGTCTAAGAATGTGAGCCAGTCACAGATGGCAAAATTGAACCAA
CAAATGGCCAAAATGATGGATCCTAGGGTTCTTCATCACATGGGTGGTATGGCAGGACTT
CAGTCAATGATGAGGCAGTTTCAACAGGGTGCTGCTGGCAACATGAAAGGCATGATGGGA
TTCAATAATATGTAA
Protein Properties
Number of Residues 504
Molecular Weight 55704.4
Theoretical pI 9.19
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Signal recognition particle 54 kDa protein
MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAI
DLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSK
LAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFK
NENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKV
DVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDI
EGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFM
SKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQEL
LTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGL
QSMMRQFQQGAAGNMKGMMGFNNM
GenBank ID Protein 189053540
UniProtKB/Swiss-Prot ID P61011
UniProtKB/Swiss-Prot Entry Name SRP54_HUMAN
PDB IDs Not Available
GenBank Gene ID AK312853
GeneCard ID SRP54
GenAtlas ID SRP54
HGNC ID HGNC:11301
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Patel S, Austen B: Sequence of the highly conserved gene encoding the human 54kDa subunit of signal recognition particle. DNA Seq. 1996;6(3):167-70. [PubMed:8722571 ]
  5. Gowda K, Black SD, Moeller I, Sakakibara Y, Liu MC, Zwieb C: Protein SRP54 of human signal recognition particle: cloning, expression, and comparative analysis of functional sites. Gene. 1998 Jan 30;207(2):197-207. [PubMed:9511762 ]
  6. Sakashita E, Tatsumi S, Werner D, Endo H, Mayeda A: Human RNPS1 and its associated factors: a versatile alternative pre-mRNA splicing regulator in vivo. Mol Cell Biol. 2004 Feb;24(3):1174-87. [PubMed:14729963 ]
  7. Clemons WM Jr, Gowda K, Black SD, Zwieb C, Ramakrishnan V: Crystal structure of the conserved subdomain of human protein SRP54M at 2.1 A resolution: evidence for the mechanism of signal peptide binding. J Mol Biol. 1999 Sep 24;292(3):697-705. [PubMed:10497032 ]
  8. Kuglstatter A, Oubridge C, Nagai K: Induced structural changes of 7SL RNA during the assembly of human signal recognition particle. Nat Struct Biol. 2002 Oct;9(10):740-4. [PubMed:12244299 ]