Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08597
Secondary Accession Numbers
  • 14312
Name Tubulin alpha-3E chain
Synonyms
  1. Alpha-tubulin 3E
Gene Name TUBA3E
Protein Type Unknown
Biological Properties
General Function Involved in structural molecule activity
Specific Function Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain
Pathways Not Available
Reactions Not Available
GO Classification
Component
macromolecular complex
protein complex
microtubule
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
structural molecule activity
gtpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Process
cellular process
cellular component organization or biogenesis
cellular component organization
cellular component assembly
macromolecular complex assembly
cellular protein complex assembly
microtubule-based process
microtubule-based movement
protein complex assembly
protein polymerization
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:2
Locus 2q21.1
SNPs TUBA3E
Gene Sequence
>1353 bp
ATGCGCGAGTGTATCTCTATCCACGTGGGGCAGGCGGGTGTCCAGATCGGCAATGCCTGC
TGGGAACTGTACTGCCTTGAACATGGAATTCAGCCCGATGGTCAAATGCCAAGTGATAAA
ACCATTGGTGGCGGGGACGACTCCTTCAACACGTTCTTCAGTGAGACTGGAGCTGGCAAG
CACGTGCCCAGAGCAGTGTTTGTGGACCTGGAGCCCACTGTGGTCGATGAAGTGCGCACA
GGGACCTACAGGCAGCTCTTCCACCCAGAGCAGCTGATCACCGGGAAGGAAGATGCAGCC
AGTAATTACGCCAGGGGCCATTACACCATCGGCAAGGAGATTGTTGACCTAGTCCTGGAC
CGGATCCGCAAACTGGCGGATCTGTGCACAGGACTGCAGGGCTTCCTCATCTTCCACAGC
TTTGGGGGCGGCACTGGCTCTGGGTTCGCATCTCTGCTCATGGAGCGGCTCTCAGTGGAT
TACAGCAAGAAGTCCAAGCTAGAGTTTGCCATTTACCCAGCCCCCCAGGTCTCCACAGCC
GTGGTGGAGCCCTACAACTCCATCCTAACCACCCACACGACCCTGGAACATTCTGACTGT
GCCTTCATGGTCGACAATGAAGCCATCTATGACATATGTCGGCGCAACCTGGACATTGAA
CGTCCCACGTACACCAACCTCAATCGCCTGATTGGGCAGATCGTGTCCTCCATCACGGCC
TCCCTGCGATTTGATGGGGCCCTGAATGTGGACTTGACGGAATTCCAGACCAACCTCGTG
CCGTACCCCCGCATCCACTTCCCCCTGGCCACCTACGCCCCAGTCATCTCAGCTGAGAAG
GCCTACCATGAGCAGCTGTCTGTGGCTGAGATCACCAATGCCTGCTTCGAGCCAGCCAAT
CAGATGGTCAAGTGTGACCCTCGCCATGGCAAGTACATGGCCTGCTGCATGTTGTACAGG
GGGGACGTGGTCCCCAAAGACGTCAATGCGGCCATCGCCACCATCAAGACCAAGCGCACT
ATCCAGTTTGTGGATTGGTGCCCGACTGGATTTAAGGTGGGCATTAACTACCAGCCCCCC
ACAGTGGTCCCCGGGGGAGACCTGGCCAAGGTGCAGCGGGCCGTGTGCATGCTGAGCAAC
ACCACGGCCATTGCGGAGGCCTGGGCCCGCCTGGTCCATAAGTTCGATCTCATGTATGCC
AAGTGGGCCTTTGTGCACTGGTACGTGGGCGAAGGCATGGAAGAGGGAGAGTTCTCTGAG
GCCCGCGAGGACCTGGCAGCTCTAGAGAAGGATTGTGAAGAGGTGGGCGTGGATTCCGTG
GAAGCTGAGGCTGAAGAAGGCGAAGAATACTGA
Protein Properties
Number of Residues 450
Molecular Weight 49858.1
Theoretical pI 4.77
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Tubulin alpha-3E chain
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAASNYARGHYTIGKEIVDLVLD
RIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYSKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLVHKFDLMYAKWAFVHWYVGEGMEEGEFSE
AREDLAALEKDCEEVGVDSVEAEAEEGEAY
GenBank ID Protein 34785523
UniProtKB/Swiss-Prot ID Q6PEY2
UniProtKB/Swiss-Prot Entry Name TBA3E_HUMAN
PDB IDs
GenBank Gene ID BC057811
GeneCard ID TUBA3E
GenAtlas ID TUBA3E
HGNC ID HGNC:20765
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R: Phosphoproteome analysis of the human mitotic spindle. Proc Natl Acad Sci U S A. 2006 Apr 4;103(14):5391-6. Epub 2006 Mar 24. [PubMed:16565220 ]
  5. Rogowski K, Juge F, van Dijk J, Wloga D, Strub JM, Levilliers N, Thomas D, Bre MH, Van Dorsselaer A, Gaertig J, Janke C: Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation. Cell. 2009 Jun 12;137(6):1076-87. doi: 10.1016/j.cell.2009.05.020. [PubMed:19524510 ]