You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08608
Secondary Accession Numbers
  • 14323
Name T-lymphoma invasion and metastasis-inducing protein 1
Synonyms
  1. TIAM-1
Gene Name TIAM1
Protein Type Unknown
Biological Properties
General Function Involved in Rho guanyl-nucleotide exchange factor activity
Specific Function Modulates the activity of RHO-like proteins and connects extracellular signals to cytoskeletal activities. Acts as a GDP- dissociation stimulator protein that stimulates the GDP-GTP exchange activity of RHO-like GTPases and activates them. Activates RAC1, CDC42, and to a lesser extent RHOA
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
binding
ras guanyl-nucleotide exchange factor activity
rho guanyl-nucleotide exchange factor activity
receptor signaling protein activity
enzyme regulator activity
protein binding
molecular transducer activity
signal transducer activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
Process
regulation of ras protein signal transduction
regulation of rho protein signal transduction
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signaling pathway
signaling
signaling pathway
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:2
Locus 21q22.1|21q22.11
SNPs TIAM1
Gene Sequence
>4776 bp
ATGGGAAACGCAGAAAGTCAACATGTAGAGCACGAGTTTTATGGAGAAAAGCATGCCAGC
CTGGGGCGCAAGCACACTTCCCGCTCCCTGCGCCTCTCGCACAAGACGCGGAGGACCAGG
CACGCTTCCTCGGGGAAGGTGATCCACAGGAACTCCGAAGTGAGCACCCGATCCAGCAGC
ACCCCCAGCATCCCCCAGTCCCTGGCTGAAAATGGCCTGGAGCCCTTCTCCCAAGATGGT
ACCCTAGAAGACTTCGGGAGCCCCATCTGGGTGGACCGAGTGGACATGGGCTTGAGACCT
GTGTCTTACACTGACTCTTCTGTCACTCCCAGCGTAGACAGCAGCATCGTCCTCACAGCA
GCCTCTGTGCAGAGCATGCCAGACACTGAGGAGAGCAGGCTTTACGGGGATGACGCTACA
TATTTGGCTGAGGGAGGCAGGAGGCAGCATTCCTATACATCCAATGGGCCCACTTTCATG
GAGACGGCGAGCTTTAAGAAGAAACGCTCCAAATCTGCAGACATCTGGCGGGAGGACAGC
CTGGAATTCTCACTCTCTGATCTGAGCCAAGAACATTTAACAAGCAACGAAGAAATCTTG
GGTTCCGCCGAAGAGAAGGACTGCGAGGAGGCTCGGGGGATGGAAACGCGGGCGAGTCCG
CGGCAGCTCAGCACCTGTCAGAGAGCCAATTCCTTGGGTGACTTGTATGCTCAGAAAAAC
TCTGGAGTGACAGCAAACGGGGGGCCGGGGAGCAAATTTGCAGGCTACTGTCGGAATTTG
GTGTCTGATATTCCCAATCTTGCAAACCATAAGATGCCACCAGCTGCTGCTGAAGAGACT
CCTCCGTACAGTAATTATAACACACTTCCCTGTAGGAAATCTCACTGTCTCTCTGAAGGT
GCCACCAACCCACAAATTAGCCATAGCAACAGCATGCAAGGCAGAAGAGCTAAAACAACT
CAGGATGTTAATGCAGGCGAGGGCAGTGAGTTTGCAGACAGTGGGATTGAAGGGGCCACT
ACCGACACGGACCTCCTGTCCAGGCGATCTAATGCCACCAACTCCAGCTACTCACCCACC
ACAGGCCGGGCCTTTGTGGGCAGCGACAGCGGCAGCAGCTCCACCGGGGATGCGGCTCGT
CAGGGGGTGTACGAGAACTTCCGGCGGGAGCTGGAGATGAGCACCACCAACAGCGAGAGC
CTGGAGGAGGCCGGCTCGGCGCACAGCGATGAGCAGAGCAGCGGCACCCTGAGCTCTCCG
GGCCAGTCGGACATCCTGCTGACCGCCGCACAGGGCACGGTGCGCAAGGCCGGCGCCCTG
GCCGTCAAGAACTTCCTGGTGCACAAGAAGAACAAGAAGGTGGAGTCAGCCACCCGGAGG
AAGTGGAAGCACTACTGGGTGTCCCTGAAAGGATGCACGCTATTTTTCTACGAGAGCGAC
GGCAGGTCTGGGATAGACCACAACAGCATCCCCAAACACGCCGTCTGGGTGGAGAACAGC
ATTGTGCAGGCGGTGCCTGAGCACCCCAAGAAGGACTTTGTCTTCTGCCTCAGCAATTCC
CTGGGTGATGCCTTCCTTTTTCAGACCACTAGCCAGACGGAGCTTGAAAACTGGATCACC
GCCATCCACTCTGCCTGCGCCACTGCGGTCGCGAGGCACCACCACAAGGAAGACACGCTC
CGACTCCTGAAATCAGAGATCAAAAAACTGGAACAGAAGATTGACATGGATGAAAAGATG
AAGAAAATGGGTGAAATGCAGCTGTCTTCAGTCACTGACTCAAAGAAAAAGAAAACAATA
TTAGATCAGATCTTTGTCTGGGAGCAAAATCTCGAGCAGTTCCAAATGGACCTGTTTCGT
TTCCGCTGTTATTTAGCCAGCCTTCAGGGTGGGGAGCTGCCAAACCCCAAAAGGCTTCTC
GCTTTTGCAAGTCGACCAACGAAAGTGGCCATGGGCCGCCTTGGAATCTTTTCGGTATCA
TCGTTTCATGCCCTGGTGGCAGCACGCACTGGTGAAACTGGAGTGAGAAGACGTACTCAG
GCCATGTCCAGATCCGCGAGCAAGCGAAGGAGCAGGTTTTCTTCTCTGTGGGGTCTGGAT
ACTACCTCCAAAAAGAAGCAGGGACGGCCAAGCATCAATCAGGTGTTTGGAGAGGGAACC
GAAGCTGTAAAGAAATCTTTAGAGGGAATATTTGATGACATTGTTCCAGATGGCAAGAGG
GAGAAAGAAGTGGTCTTACCTAACGTTCACCAGCACAACCCTGACTGCGACATTTGGGTC
CACGAGTATTTCACTCCATCCTGGTTCTGTCTGCCCAATAATCAGCCTGCCCTGACGGTC
GTCCGGCCAGGCGACACTGCACGGGACACCCTGGAGCTGATTTGCAAGACACATCAACTG
GATCATTCTGCTCATTACCTGCGCCTGAAATTTCTAATAGAAAACAAAATGCAGCTCTAT
GTTCCACAGCCCGAGGAAGACATCTATGAGCTGCTGTACAAAGAAATTGAAATCTGTCCA
AAAGTCACTCAGAGCATCCACATTGAGAAGTCAGATACAGCTGCTGATACTTACGGGTTT
TCACTTTCTTCTGTGGAAGAAGATGGTATTCGAAGGCTGTACGTGAATAGTGTGAAGGAA
ACCGGTTTAGCTTCCAAGAAAGGCCTGAAAGCAGGAGATGAGATTCTTGAGATCAATAAT
CGTGCTGCTGACGCCCTGAACTCTTCTATGCTCAAAGATTTCCTCTCACAGCCCTCGCTG
GGCCTCCTGGTGAGGACCTACCCCGAGCTGGAGGAAGGAGTGGAGCTGCTGGAAAGCCCG
CCCCACCGAGTGGACGGCCCTGCCGACCTTGGCGAGAGCCCCCTCGCCTTTCTCACCAGC
AACCCAGGGCACAGCCTTTGCAGCGAGCAGGGCAGCAGTGCTGAGACCGCTCCAGAGGAG
ACCGAGGGGCCAGACTTGGAATCCTCAGATGAGACTGATCACAGCAGCAAGAGTACAGAA
CAGGTGGCCGCATTTTGCCGCAGTTTGCATGAGATGAACCCCTCTGACCAGAGCCCATCT
CCTCAGGACTCCACGGGGCCTCAGCTGGCGACCATGAGACAACTCTCGGATGCAGATAAG
CTGCGCAAGGTGATCTGCGAGCTCCTGGAGACGGAGCGCACCTACGTGAAGGATTTAAAC
TGTCTTATGGAGAGATACCTAAAGCCTCTTCAAAAAGAAACTTTTCTCACCCAGGATGAG
CTTGACGTGCTTTTTGGAAATTTAACGGAAATGGTAGAGTTTCAAGTAGAATTCCTTAAA
ACTCTAGAAGATGGAGTGAGACTGGTACCTGATTTGGAAAAGCTTGAGAAGGTTGATCAA
TTTAAGAAAGTGCTGTTCTCTCTGGGGGGATCATTCCTGTATTATGCTGACCGCTTCAAG
CTCTACAGTGCCTTCTGCGCCAGCCACACAAAAGTTCCCAAGGTCCTGGTGAAAGCCAAG
ACAGACACGGCTTTCAAGGCATTCTTGGATGCCCAGAACCCGAAGCAGCAGCACTCATCC
ACGCTGGAGTCGTACCTCATCAAGCCCATCCAGAGGATCCTCAAGTACCCACTTCTGCTC
AGGGAGCTGTTCGCCCTGACCGATGCGGAGAGCGAGGAGCACTACCACCTGGACGTGGCC
ATCAAGACCATGAACAAGGTTGCCAGTCACATCAATGAGATGCAGAAAATCCATGAAGAG
TTTGGGGCTGTGTTTGACCAGCTGATTGCTGAACAGACTGGTGAGAAAAAAGAGGTTGCA
GATCTGAGCATGGGAGACCTGCTTTTGCACACTACCGTGATCTGGCTGAACCCGCCGGCC
TCGCTGGGCAAGTGGAAAAAGGAACCAGAGTTGGCAGCATTCGTCTTCAAAACTGCTGTG
GTCCTTGTGTATAAAGATGGTTCCAAACAGAAGAAGAAACTTGTAGGATCTCACAGGCTT
TCCATTTATGAGGACTGGGACCCCTTCAGATTTCGACACATGATCCCCACGGAAGCGCTG
CAGGTTCGAGCTTTGGCGAGTGCAGATGCAGAGGCAAATGCCGTGTGTGAAATTGTCCAT
GTAAAATCCGAGTCTGAAGGGAGGCCGGAGAGGGTCTTTCACTTGTGCTGCAGCTCCCCA
GAGAGCCGAAAGGATTTCCTAAAGGCTGTGCATTCAATCCTGCGTGATAAGCACAGAAGA
CAGCTCCTCAAAACCGAGAGCCTTCCCTCATCCCAGCAATATGTCCCTTTTGGAGGCAAA
AGATTGTGTGCACTGAAGGGGGCCAGGCCGGCCATGAGCAGGGCAGTGTCTGCCCCAAGC
AAGTCTCTTGGGAGGAGGAGGCGGCGGCTGGCTCGAAACAGGTTTACCATTGATTCTGAT
GCCGTCTCCGCAAGCAGCCCGGAGAAAGAGTCCCAGCAGCCCCCCGGTGGTGGGGACACT
GACCGATGGGTAGAGGAGCAGTTTGATCTTGCTCAGTATGAGGAGCAAGATGACATCAAG
GAGACAGACATCCTCAGTGACGATGATGAGTTCTGTGAGTCCGTGAAGGGTGCCTCAGTG
GACAGAGACCTGCAGGAGCGGCTTCAGGCCACCTCCATCAGTCAGCGGGAAAGAGGCCGG
AAAACCCTGGATAGTCACGCGTCCCGCATGGCACAGCTCAAGAAGCAAGCTGCCCTGTCG
GGGATCAATGGAGGCCTGGAGAGCGCAAGCGAGGAAGTCATTTGGGTTAGGCGTGAAGAC
TTTGCCCCCTCCAGGAAACTGAACACTGAGATCTGA
Protein Properties
Number of Residues 1591
Molecular Weight 177506.5
Theoretical pI 6.58
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>T-lymphoma invasion and metastasis-inducing protein 1
MGNAESQHVEHEFYGEKHASLGRKHTSRSLRLSHKTRRTRHASSGKVIHRNSEVSTRSSS
TPSIPQSLAENGLEPFSQDGTLEDFGSPIWVDRVDMGLRPVSYTDSSVTPSVDSSIVLTA
ASVQSMPDTEESRLYGDDATYLAEGGRRQHSYTSNGPTFMETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSAEEKDCEEARGMETRASPRQLSTCQRANSLGDLYAQKN
SGVTANGGPGSKFAGYCRNLVSDIPNLANHKMPPAAAEETPPYSNYNTLPCRKSHCLSEG
ATNPQISHSNSMQGRRAKTTQDVNAGEGSEFADSGIEGATTDTDLLSRRSNATNSSYSPT
TGRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSP
GQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESD
GRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWIT
AIHSACATAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTI
LDQIFVWEQNLEQFQMDLFRFRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVS
SFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEGT
EAVKKSLEGIFDDIVPDGKREKEVVLPNVHQHNPDCDIWVHEYFTPSWFCLPNNQPALTV
VRPGDTARDTLELICKTHQLDHSAHYLRLKFLIENKMQLYVPQPEEDIYELLYKEIEICP
KVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINN
RAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVELLESPPHRVDGPADLGESPLAFLTS
NPGHSLCSEQGSSAETAPEETEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNPSDQSPS
PQDSTGPQLATMRQLSDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDE
LDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFK
LYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPKQQHSSTLESYLIKPIQRILKYPLLL
RELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA
DLSMGDLLLHTTVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRL
SIYEDWDPFRFRHMIPTEALQVRALASADAEANAVCEIVHVKSESEGRPERVFHLCCSSP
ESRKDFLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPS
KSLGRRRRRLARNRFTIDSDAVSASSPEKESQQPPGGGDTDRWVEEQFDLAQYEEQDDIK
ETDILSDDDEFCESVKGASVDRDLQERLQATSISQRERGRKTLDSHASRMAQLKKQAALS
GINGGLESASEEVIWVRREDFAPSRKLNTEI
GenBank ID Protein 115583670
UniProtKB/Swiss-Prot ID Q13009
UniProtKB/Swiss-Prot Entry Name TIAM1_HUMAN
PDB IDs
GenBank Gene ID NM_003253.2
GeneCard ID TIAM1
GenAtlas ID TIAM1
HGNC ID HGNC:11805
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  6. Hattori M, Fujiyama A, Taylor TD, Watanabe H, Yada T, Park HS, Toyoda A, Ishii K, Totoki Y, Choi DK, Groner Y, Soeda E, Ohki M, Takagi T, Sakaki Y, Taudien S, Blechschmidt K, Polley A, Menzel U, Delabar J, Kumpf K, Lehmann R, Patterson D, Reichwald K, Rump A, Schillhabel M, Schudy A, Zimmermann W, Rosenthal A, Kudoh J, Schibuya K, Kawasaki K, Asakawa S, Shintani A, Sasaki T, Nagamine K, Mitsuyama S, Antonarakis SE, Minoshima S, Shimizu N, Nordsiek G, Hornischer K, Brant P, Scharfe M, Schon O, Desario A, Reichelt J, Kauer G, Blocker H, Ramser J, Beck A, Klages S, Hennig S, Riesselmann L, Dagand E, Haaf T, Wehrmeyer S, Borzym K, Gardiner K, Nizetic D, Francis F, Lehrach H, Reinhardt R, Yaspo ML: The DNA sequence of human chromosome 21. Nature. 2000 May 18;405(6784):311-9. [PubMed:10830953 ]
  7. Habets GG, van der Kammen RA, Stam JC, Michiels F, Collard JG: Sequence of the human invasion-inducing TIAM1 gene, its conservation in evolution and its expression in tumor cell lines of different tissue origin. Oncogene. 1995 Apr 6;10(7):1371-6. [PubMed:7731688 ]
  8. Michiels F, Habets GG, Stam JC, van der Kammen RA, Collard JG: A role for Rac in Tiam1-induced membrane ruffling and invasion. Nature. 1995 May 25;375(6529):338-40. [PubMed:7753201 ]
  9. Habets GG, van der Kammen RA, Jenkins NA, Gilbert DJ, Copeland NG, Hagemeijer A, Collard JG: The invasion-inducing TIAM1 gene maps to human chromosome band 21q22 and mouse chromosome 16. Cytogenet Cell Genet. 1995;70(1-2):48-51. [PubMed:7736788 ]
  10. Connolly BA, Rice J, Feig LA, Buchsbaum RJ: Tiam1-IRSp53 complex formation directs specificity of rac-mediated actin cytoskeleton regulation. Mol Cell Biol. 2005 Jun;25(11):4602-14. [PubMed:15899863 ]