You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08614
Secondary Accession Numbers
  • 14329
Name 116 kDa U5 small nuclear ribonucleoprotein component
Synonyms
  1. Elongation factor Tu GTP-binding domain-containing protein 2
  2. SNU114 homolog
  3. U5 snRNP-specific protein, 116 kDa
  4. U5-116 kDa
  5. hSNU114
Gene Name EFTUD2
Protein Type Unknown
Biological Properties
General Function Involved in GTPase activity
Specific Function Component of the U5 snRNP complex required for pre-mRNA splicing
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
gtpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:1
Locus 17q21.31
SNPs EFTUD2
Gene Sequence
>2919 bp
ATGGATACCGACTTATATGATGAGTTTGGGAATTATATTGGACCAGAGCTTGATTCTGAT
GAAGATGATGATGAATTGGGTAGAGAGACCAAAGATCTTGATGAGATGGATGATGATGAC
GACGACGATGACGTAGGAGATCATGACGATGACCACCCTGGGATGGAGGTGGTGCTGCAT
GAGGACAAGAAGTACTACCCAACAGCCGAGGAGGTGTATGGTCCTGAGGTGGAGACCATA
GTTCAAGAGGAAGACACTCAGCCTCTCACAGAACCCATTATTAAGCCAGTGAAAACCAAG
AAATTCACTCTGATGGAGCAGACATTACCTGTTACGGTGTATGAGATGGATTTCTTGGCG
GATCTGATGGATAACTCAGAGCTCATCAGAAATGTGACCCTTTGTGGACATCTCCACCAT
GGCAAGACATGTTTTGTGGATTGTTTAATTGAACAGACTCACCCGGAAATCAGAAAGCGC
TATGACCAAGATCTGTGCTATACTGACATCCTCTTCACAGAGCAAGAGAGAGGTGTAGGC
ATCAAAAGCACTCCTGTGACAGTGGTCTTGCCAGACACCAAAGGAAAATCTTATCTCTTC
AATATCATGGACACTCCAGGACATGTGAATTTCTCTGATGAGGTCACAGCTGGCTTGCGC
ATCTCAGATGGAGTGGTCCTTTTCATTGATGCTGCTGAGGGGGTGATGCTGAACACAGAG
CGGCTGATCAAGCATGCGGTGCAGGAGAGGCTGGCAGTCACTGTGTGCATCAACAAGATT
GACCGGCTGATCCTGGAGCTGAAGCTGCCTCCAACTGATGCTTATTACAAGCTGCGCCAC
ATTGTGGATGAGGTCAATGGATTAATAAGCATGTATTCCACTGATGAGAACCTGATCCTT
TCCCCACTCCTGGGTAACGTCTGCTTCTCCAGCTCCCAGTACAGCATCTGCTTCACGCTG
GTCTCCTTTGCCAAGATCTATGCCGACACCTTTGGTGACATTAATTACCAAGAATTTGCT
AAAAGACTCTGGGGTGACATCTACTTCAACCCTAAGACGCGAAAGTTCACCAAAAAGGCC
CCAACTAGCAGCTCCCAGAGAAGTTTCGTGGAGTTTATCTTGGAGCCTCTTTATAAGATC
CTCGCCCAGGTTGTAGGTGACGTGGACACCAGCCTCCCACGGACCCTAGACGAGCTTGGC
ATCCACCTGACGAAGGAGGAGCTGAAGCTGAACATCCGCCCCTTGCTCAGGCTGGTCTGC
AAAAAGTTCTTTGGCGAGTTCACAGGCTTTGTGGACATGTGTGTGCAGCATATCCCTTCT
CCAAAGGTGGGCGCCAAGCCCAAGATTGAGCACACCTACACCGGTGGTGTGGACTCCGAC
CTCGGCGAGGCTATGAGTGACTGTGACCCTGATGGCCCCCTGATGTGCCACACTACTAAG
ATGTACAGCACAGATGATGGAGTCCAGTTTCACGCCTTTGGCCGGGTGCTGAGTGGCACC
ATTCATGCTGGGCAGCCTGTGAAGGTACTGGGGGAGAACTACACCCTGGAGGATGAGGAA
GACTCCCAGATATGCACCGTGGGCCGCCTTTGGATCTCTGTGGCCAGGTACCACATCGAG
GTGAACCGTGTTCCTGCTGGCAACTGGGTTCTGATTGAAGGTGTTGATCAACCAATTGTG
AAGACAGCAACCATAACCGAACCCCGAGGCAATGAGGAGGCTCAGATTTTCCGACCCTTG
AAGTTCAATACCACATCTGTTATCAAGATTGCTGTGGAGCCAGTCAACCCCTCAGAGCTG
CCCAAGATGCTTGATGGCCTGCGCAAGGTCAACAAGAGCTATCCATCCCTCACCACCAAG
GTGGAGGAGTCTGGCGAGCATGTGATCCTGGGCACTGGGGAGCTCTACCTGGACTGTGTG
ATGCATGATTTGCGGAAGATGTACTCAGAGATAGACATCAAGGTGGCTGACCCAGTTGTC
ACGTTTTGTGAGACGGTGGTGGAAACATCCTCCCTCAAGTGCTTTGCTGAAACGCCTAAT
AAGAAGAACAAGATCACCATGATTGCTGAGCCTCTTGAGAAGGGCCTGGCAGAGGACATA
GAGAATGAGGTGGTCCAGATTACGTGGAACAGGAAGAAGCTGGGAGAGTTCTTCCAGACC
AAGTACGATTGGGATCTGCTGGCTGCCCGTTCCATCTGGGCTTTTGGCCCTGATGCGACT
GGCCCCAACATTCTGGTGGATGATACTCTGCCCTCTGAGGTGGACAAGGCTCTTCTTGGT
TCAGTGAAGGACAGCATCGTTCAAGGTTTCCAGTGGGGAACCAGGGAGGGCCCCCTCTGT
GATGAATTGATTCGGAATGTCAAGTTTAAGATCCTGGATGCGGTGGTTGCCCAGGAGCCC
CTGCACCGGGGCGGGGGCCAGATCATCCCCACAGCCAGGAGAGTCGTCTACTCTGCCTTC
CTCATGGCTACTCCTCGTCTGATGGAGCCTTACTACTTTGTAGAGGTCCAGGCCCCTGCA
GATTGCGTCTCTGCAGTTTATACCGTCCTGGCCAGGCGCAGGGGGCACGTGACTCAGGAT
GCACCCATCCCAGGCTCCCCTCTGTACACCATCAAAGCTTTTATCCCGGCCATCGACTCT
TTTGGCTTTGAGACTGATCTCCGGACTCACACCCAGGGACAAGCCTTTTCTCTGTCTGTC
TTCCACCACTGGCAGATTGTGCCTGGTGATCCCCTGGACAAGAGCATTGTCATCCGCCCC
TTGGAGCCACAGCCAGCTCCTCACCTGGCCCGGGAATTCATGATCAAAACCCGCCGTAGG
AAGGGCCTCAGTGAAGATGTGAGCATCAGCAAATTCTTCGATGATCCTATGTTGCTGGAA
CTTGCCAAACAGGATGTTGTGCTCAATTACCCCATGTGA
Protein Properties
Number of Residues 972
Molecular Weight 109434.8
Theoretical pI 4.6
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>116 kDa U5 small nuclear ribonucleoprotein component
MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLH
EDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLA
DLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVG
IKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTE
RLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLIL
SPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKA
PTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVC
KKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK
MYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIE
VNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSEL
PKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVV
TFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQT
KYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLC
DELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPA
DCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSV
FHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLE
LAKQDVVLNYPM
GenBank ID Protein 12803113
UniProtKB/Swiss-Prot ID Q15029
UniProtKB/Swiss-Prot Entry Name U5S1_HUMAN
PDB IDs Not Available
GenBank Gene ID BC002360
GeneCard ID EFTUD2
GenAtlas ID EFTUD2
HGNC ID HGNC:30858
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  7. Nomura N, Miyajima N, Sazuka T, Tanaka A, Kawarabayasi Y, Sato S, Nagase T, Seki N, Ishikawa K, Tabata S: Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1. DNA Res. 1994;1(1):27-35. [PubMed:7584026 ]
  8. Jurica MS, Licklider LJ, Gygi SR, Grigorieff N, Moore MJ: Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis. RNA. 2002 Apr;8(4):426-39. [PubMed:11991638 ]
  9. Fabrizio P, Laggerbauer B, Lauber J, Lane WS, Luhrmann R: An evolutionarily conserved U5 snRNP-specific protein is a GTP-binding factor closely related to the ribosomal translocase EF-2. EMBO J. 1997 Jul 1;16(13):4092-106. [PubMed:9233818 ]
  10. Achsel T, Ahrens K, Brahms H, Teigelkamp S, Luhrmann R: The human U5-220kD protein (hPrp8) forms a stable RNA-free complex with several U5-specific proteins, including an RNA unwindase, a homologue of ribosomal elongation factor EF-2, and a novel WD-40 protein. Mol Cell Biol. 1998 Nov;18(11):6756-66. [PubMed:9774689 ]