You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08616
Secondary Accession Numbers
  • 14331
Name WD repeat-containing protein 44
Synonyms
  1. Rabphilin-11
Gene Name WDR44
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Downstream effector for RAB11. May be involved in vesicle recycling
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cytoplasm
  2. Cytoplasm
  3. perinuclear region
  4. Endosome membrane
  5. Golgi apparatus
  6. cytosol
  7. trans-Golgi network
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs WDR44
Gene Sequence
>2742 bp
ATGGCGTCGGAAAGCGACACCGAGGAATTCTATGATGCCCCTGAAGATGTGCACCTAGGG
GGCGGCTACCCCGTGGGGTCTCCAGGAAAAGTTGGGCTTTCAACATTCAAGGAAACAGAG
AACACTGCATACAAAGTTGGAAATGAGTCCCCTGTACAAGAATTGAAACAAGATGTGTCT
AAAAAGATTATTGAAAGTATTATTGAGGAGAGTCAGAAAGTACTACAGCTTGAAGATGAC
TCTTTGGATTCCAAAGGAAAAGAACTCTCTGATCAAGCTACTGCCAGTCCTATTGTGGCT
AGAACAGATCTGAGCAATATACCCGGACTGTTAGCCATAGATCAAGTACTACCGGAAGAA
TCCCAAAAGGCAGAGAGTCAGAATACATTTGAAGAGACTGAATTAGAATTAAAAAAATGC
TTTCCTTCTGATGAAACCTGTGAGAAACCAGTAGATGAAACCACGAAGTTAACTCAAACA
AGTTCAACTGAGCAGCTTAATGTGCTTGAAACTGAAACAGAAGTATTGAACAAGGAAGCA
GTGGAAGTCAAAGGAGGTGGTGATGTTTTAGAGCCTGTGTCCTCAGACTCCTTATCTACT
AAAGATTTTGCCGCTGTGGAAGAAGTGGCCCCTGCCAAACCCCCAAGACACCTTACTCCA
GAGCCTGATATAGTGGCTAGTACAAAGAAGCCTGTTCCAGCACGCCCACCTCCTCCAACT
AATTTCCCACCTCCTAGACCCCCACCTCCTTCTCGACCTGCTCCACCACCAAGAAAAAGG
AAAAGCGAATTGGAATTTGAGACTCTGAAAACTCCTGATATAGATGTTCCCAAAGAGAAT
ATTACGTCTGATTCTCTCCTAACCGCAAGCATGGCTTCAGAAAGTACGGTTAAGGATTCT
CAGCCTTCTCTTGATTTGGCAAGTGCTACCAGTGGAGATAAAATAGTTACCGCCCAGGAA
AATGGAAAAGCACCTGATGGGCAGACTGTAGCAGGTGAAGTGATGGGCCCTCAGAGACCT
AGATCCAACTCTGGGAGAGAGCTTACTGATGAGGAAATTTTAGCCAGTGTAATGATTAAG
AACCTGGATACTGGAGAAGAAATACCTTTGAGTCTTGCAGAAGAGAAACTACCAACAGGC
ATTAATCCTCTCACTCTACACATCATGAGAAGGACAAAAGAATATGTAAGTAATGACGCG
GCACAGTCAGATGATGAAGAGAAGTTACAGTCTCAGCCAACAGATACTGATGGTGGAAGG
TTAAAACAGAAAACGACTCAACTAAAGAAGTTTCTTGGAAAATCAGTAAAGAGAGCAAAG
CACCTTGCTGAGGAATATGGTGAACGTGCTATAAATAAAGTTAAAAGTGTTAGAGATGAA
GTGTTTCATACTGATCAAGATGATCCTTCATCAAGTGATGATGAAGGAATGCCATACACA
AGACCAGTTAAATTCAAAGCAGCACACGGTTTCAAAGGACCTTATGATTTTGATCAGATC
AAAGTGGTGCAAGATCTTAGTGGTGAACATATGGGAGCTGTTTGGACCATGAAATTTTCT
CACTGTGGCCGATTACTTGCCTCAGCTGGACAAGACAATGTAGTGAGAATATGGGCTTTA
AAAAATGCTTTTGACTATTTCAACAATATGCGAATGAAATACAATACTGAAGGACGTGTG
TCCCCATCACCCTCTCAGGAAAGTCTAAGTTCATCAAAATCGGATACAGATACAGGGGTA
TGCAGTGGAACTGATGAAGACCCTGATGATAAAAACGCACCCTTTCGGCAACGGCCATTT
TGCAAATATAAAGGACATACTGCTGATCTCCTTGATCTTTCATGGTCTAAAAACTACTTT
CTTCTTTCTTCTTCAATGGATAAAACAGTCAGATTATGGCACATTTCTCGAAGAGAATGC
CTTTGCTGTTTTCAACATATAGATTTTGTCACTGCCATAGCTTTTCATCCAAGAGATGAC
AGGTATTTTCTAAGTGGGTCTTTGGATGGAAAGCTCCGCCTTTGGAACATACCTGACAAA
AAAGTGGCTTTGTGGAATGAAGTAGATGGTCAGACAAAATTGATCACAGCTGCAAATTTC
TGTCAGAATGGCAAATATGCAGTGATTGGGACATATGATGGCAGATGTATTTTCTATGAT
ACAGAGCATTTGAAATACCATACACAAATACATGTCCGATCTACTAGAGGGCGCAACAAG
GTTGGAAGAAAAATTACTGGCATTGAGCCTTTACCTGGAGAAAATAAGATATTGGTAACC
TCAAATGACTCCAGAATCAGACTATATGATTTGAGAGATTTGTCACTATCCATGAAGTAT
AAGGGTTACGTCAATAGCAGCAGCCAGATCAAAGCAAGTTTCAGCCATGATTTTACTTAC
CTCGTTAGTGGTTCAGAAGATAAGTATGTTTATATCTGGAGTACCTACCATGACCTAAGC
AAGTTTACTTCAGTCAGGAGAGATCGTAATGACTTCTGGGAAGGTATTAAAGCCCACAAT
GCAGTTGTTACATCAGCCATCTTTGCACCAAACCCAAGTTTGATGTTATCTTTGGATGTG
CAATCTGAAAAATCAGAAGGGAACGAGAAAAGTGAAGATGCTGAAGTTTTGGATGCCACA
CCTTCTGGTATTATGAAGACAGATAACACAGAAGTTCTTCTCTCTGCTGACTTCACTGGA
GCAATCAAAGTGTTTGTTAATAAAAGAAAAAATGTATCTTAA
Protein Properties
Number of Residues 913
Molecular Weight 101365.4
Theoretical pI 5.1
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>WD repeat-containing protein 44
MASESDTEEFYDAPEDVHLGGGYPVGSPGKVGLSTFKETENTAYKVGNESPVQELKQDVS
KKIIESIIEESQKVLQLEDDSLDSKGKELSDQATASPIVARTDLSNIPGLLAIDQVLPEE
SQKAESQNTFEETELELKKCFPSDETCEKPVDETTKLTQTSSTEQLNVLETETEVLNKEA
VEVKGGGDVLEPVSSDSLSTKDFAAVEEVAPAKPPRHLTPEPDIVASTKKPVPARPPPPT
NFPPPRPPPPSRPAPPPRKRKSELEFETLKTPDIDVPKENITSDSLLTASMASESTVKDS
QPSLDLASATSGDKIVTAQENGKAPDGQTVAGEVMGPQRPRSNSGRELTDEEILASVMIK
NLDTGEEIPLSLAEEKLPTGINPLTLHIMRRTKEYVSNDAAQSDDEEKLQSQPTDTDGGR
LKQKTTQLKKFLGKSVKRAKHLAEEYGERAINKVKSVRDEVFHTDQDDPSSSDDEGMPYT
RPVKFKAAHGFKGPYDFDQIKVVQDLSGEHMGAVWTMKFSHCGRLLASAGQDNVVRIWAL
KNAFDYFNNMRMKYNTEGRVSPSPSQESLSSSKSDTDTGVCSGTDEDPDDKNAPFRQRPF
CKYKGHTADLLDLSWSKNYFLLSSSMDKTVRLWHISRRECLCCFQHIDFVTAIAFHPRDD
RYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFCQNGKYAVIGTYDGRCIFYD
TEHLKYHTQIHVRSTRGRNKVGRKITGIEPLPGENKILVTSNDSRIRLYDLRDLSLSMKY
KGYVNSSSQIKASFSHDFTYLVSGSEDKYVYIWSTYHDLSKFTSVRRDRNDFWEGIKAHN
AVVTSAIFAPNPSLMLSLDVQSEKSEGNEKSEDAEVLDATPSGIMKTDNTEVLLSADFTG
AIKVFVNKRKNVS
GenBank ID Protein 45238858
UniProtKB/Swiss-Prot ID Q5JSH3
UniProtKB/Swiss-Prot Entry Name WDR44_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_019045.4
GeneCard ID WDR44
GenAtlas ID WDR44
HGNC ID HGNC:30512
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  8. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  9. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  10. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  11. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  12. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  13. Molina H, Horn DM, Tang N, Mathivanan S, Pandey A: Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry. Proc Natl Acad Sci U S A. 2007 Feb 13;104(7):2199-204. Epub 2007 Feb 7. [PubMed:17287340 ]