You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08620
Secondary Accession Numbers
  • 14335
Name Exportin-5
Synonyms
  1. Exp5
  2. Ran-binding protein 21
Gene Name XPO5
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Mediates the nuclear export of micro-RNA precursors, which form short hairpins. Also mediates the nuclear export of synthetic short hairpin RNAs used for RNA interference, and adenovirus VA1 dsRNA. In some circumstances can also mediate the nuclear export of deacylated and aminoacylated tRNAs. Specifically recognizes dsRNAs that lack a 5'-overhang in a sequence- independent manner, have only a short 3'-overhang, and that have a double-stranded length of at least 15 base-pairs. Binding is dependent on Ran-GTP
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:6
Locus 6p21.1
SNPs XPO5
Gene Sequence
>3615 bp
ATGGCGATGGATCAAGTAAACGCGCTGTGCGAGCAGCTGGTGAAAGCGGTGACGGTCATG
ATGGACCCCAACTCCACCCAGCGCTACCGGCTGGAAGCCCTCAAGTTTTGTGAGGAGTTT
AAAGAAAAGTGTCCTATCTGTGTCCCCTGTGGCTTGAGGTTGGCTGAGAAAACACAAGTT
GCCATCGTCAGACATTTTGGCCTTCAGATCCTGGAACACGTTGTCAAGTTTCGGTGGAAC
GGCATGTCTCGATTGGAGAAGGTGTATCTGAAGAACAGTGTCATGGAGCTGATTGCAAAT
GGAACATTGAACATTTTGGAAGAGGAGAACCATATTAAAGATGCTCTGTCTCGAATTGTA
GTGGAAATGATCAAGCGAGAGTGGCCACAGCATTGGCCTGACATGCTAATAGAATTGGAC
ACTCTTTCCAAACAAGGGGAAACACAGACAGAATTGGTGATGTTTATCCTTTTGCGACTG
GCAGAGGATGTAGTGACTTTTCAGACACTTCCCCCTCAAAGAAGAAGGGACATCCAGCAA
ACATTAACCCAGAACATGGAAAGGATCTTCAGTTTTCTGCTTAACACACTTCAAGAAAAT
GTAAACAAGTATCAGCAAGTGAAGACAGATACTTCTCAGGAGTCAAAGGCGCAAGCAAAC
TGTCGAGTAGGAGTTGCAGCACTGAATACTCTAGCAGGCTATATTGACTGGGTGTCTATG
AGTCACATCACTGCTGAAAACTGTAAACTCCTGGAGATACTGTGTTTGCTGTTGAATGAA
CAGGAACTTCAGTTGGGAGCCGCTGAGTGTCTTCTCATTGCAGTCAGCAGAAAAGGCAAG
TTGGAAGACCGGAAGCCCTTGATGGTCTTATTTGGAGATGTTGCCATGCATTATATACTC
TCCGCCGCACAGACTGCTGATGGAGGAGGTTTGGTAGAAAAACACTACGTCTTTCTGAAG
AGGCTCTGTCAGGTGTTGTGTGCGCTGGGCAATCAGCTGTGTGCATTGCTGGGTGCAGAT
TCTGATGTAGAAACACCATCAAACTTTGGAAAATACCTGGAATCTTTTCTTGCTTTCACA
ACCCATCCAAGTCAGTTTCTACGCTCTTCAACTCAGATGACTTGGGGAGCCCTCTTCAGG
CATGAAATCCTGTCCCGTGATCCTTTGCTATTAGCAATAATACCAAAATATCTTCGTGCT
TCCATGACTAACTTGGTCAAGATGGGCTTTCCTTCTAAAACAGACAGCCCTAGCTGTGAA
TATTCTCGGTTTGATTTTGATAGCGATGAGGACTTCAATGCTTTCTTCAACTCCTCCCGA
GCACAACAAGGAGAGGTGATGAGGTTGGCATGTCGTTTGGATCCCAAAACTAGCTTCCAG
ATGGCTGGGGAGTGGCTAAAGTATCAACTATCAACTTTTCTTGATGCTGGTTCTGTGAAT
TCTTGTTCTGCAGTTGGAACTGGAGAAGGAAGCCTCTGTTCCGTCTTCTCACCTTCATTC
GTGCAGTGGGAAGCCATGACTCTTTTTTTGGAAAGTGTTATCACCCAGATGTTTCGAACA
CTAAATAGAGAAGAAATTCCTGTTAATGATGGAATAGAGCTATTGCAGATGGTTCTGAAC
TTTGATACCAAGGATCCCCTCATCCTGTCCTGCGTCCTTACTAATGTCTCTGCACTCTTT
CCATTTGTCACCTACAGACCAGAGTTCCTGCCCCAGGTCTTCTCTAAGCTATTTTCATCT
GTCACTTTTGAAACTGTTGAAGAAAGTAAGGCCCCCAGAACCCGGGCAGTGAGGAATGTG
AGGAGGCATGCTTGTTCCTCCATCATCAAGATGTGTCGTGACTACCCCCAGCTTGTGCTG
CCCAATTTTGACATGCTTTATAACCATGTGAAGCAACTCCTCTCCAATGAGCTACTCCTG
ACACAAATGGAGAAGTGTGCCCTCATGGAAGCCCTGGTTCTCATTAGCAACCAATTTAAG
AACTACGAGCGTCAGAAGGTGTTCCTAGAGGAGCTGATGGCACCAGTGGCCAGCATCTGG
CTTTCTCAAGACATGCACAGAGTGCTGTCAGATGTTGATGCTTTCATTGCGTATGTGGGT
ACAGATCAGAAGAGCTGTGACCCAGGCCTGGAGGATCCGTGTGGCTTAAACCGTGCACGA
ATGAGCTTTTGTGTATACAGCATTCTGGGTGTGGTGAAACGAACTTGCTGGCCCACTGAC
CTAGAAGAGGCCAAAGCTGGGGGATTTGTGGTGGGTTATACATCCAGTGGAAATCCAATC
TTCCGTAACCCCTGCACAGAGCAGATTCTGAAACTTCTTGACAATTTGCTTGCGCTTATA
AGAACCCACAATACATTATATGCACCAGAAATGCTAGCCAAAATGGCAGAGCCTTTCACC
AAGGCTCTGGATATGCTTGACGCGGAAAAATCTGCTATATTAGGATTACCTCAACCTCTC
TTGGAACTCAATGACTCTCCTGTCTTCAAAACCGTCTTGGAAAGAATGCAGCGTTTCTTC
TCTACCCTCTATGAAAACTGTTTTCATATCCTAGGGAAGGCAGGCCCTTCCATGCAGCAA
GACTTCTATACTGTGGAGGACCTTGCTACCCAGCTTCTCAGCTCAGCCTTTGTCAACTTG
AACAATATTCCTGACTACCGACTCAGACCCATGCTTCGTGTCTTTGTAAAGCCTCTGGTG
CTCTTCTGTCCCCCAGAGCACTATGAAGCCCTGGTATCCCCCATCCTCGGACCTCTTTTC
ACCTACCTCCATATGAGGCTTTCTCAGAAATGGCAAGTTATCAACCAAAGGAGCCTGCTG
TGTGGAGAAGATGAGGCTGCAGATGAAAACCCAGAGTCTCAAGAGATGCTGGAGGAGCAA
CTGGTGAGGATGTTAACCCGAGAAGTCATGGACCTAATCACGGTTTGCTGTGTTTCAAAG
AAGGGTGCTGACCACAGTAGTGCTCCCCCAGCAGATGGAGACGATGAAGAAATGATGGCC
ACAGAGGTCACCCCCTCAGCTATGGCAGAGCTTACAGACCTGGGCAAATGTCTGATGAAG
CATGAGGATGTTTGTACAGCGCTATTAATTACAGCCTTCAATTCCCTGGCCTGGAAAGAT
ACTCTGTCCTGCCAGAGGACAACCTCACAGCTCTGCTGGCCTCTCCTCAAACAAGTGCTG
TCAGGGACACTGCTCGCAGATGCAGTTACGTGGCTTTTCACCAGTGTGCTGAAAGGCTTA
CAGATGCACGGGCAGCACGACGGGTGCATGGCTTCCCTGGTCCATCTGGCCTTCCAGATA
TACGAGGCACTGCGCCCCAGGTACCTGGAGATAAGAGCTGTAATGGAGCAAATCCCTGAA
ATACAGAAGGACTCACTGGACCAGTTTGACTGCAAGCTTTTAAACCCCTCCCTGCAGAAA
GTGGCTGACAAGCGCCGAAAGGACCAATTCAAACGCCTCATTGCTGGTTGCATTGGGAAA
CCCTTGGGAGAGCAGTTCCGAAAAGAAGTTCACATTAAGAATCTTCCCTCACTTTTCAAA
AAAACAAAGCCAATGCTGGAGACGGAGGTGCTGGACAATGATGGGGGTGGCCTGGCCACC
ATCTTTGAACCCTGA
Protein Properties
Number of Residues 1204
Molecular Weight 136309.9
Theoretical pI 5.55
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Exportin-5
MAMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEKCPICVPCGLRLAEKTQV
AIVRHFGLQILEHVVKFRWNGMSRLEKVYLKNSVMELIANGTLNILEEENHIKDALSRIV
VEMIKREWPQHWPDMLIELDTLSKQGETQTELVMFILLRLAEDVVTFQTLPPQRRRDIQQ
TLTQNMERIFSFLLNTLQENVNKYQQVKTDTSQESKAQANCRVGVAALNTLAGYIDWVSM
SHITAENCKLLEILCLLLNEQELQLGAAECLLIAVSRKGKLEDRKPLMVLFGDVAMHYIL
SAAQTADGGGLVEKHYVFLKRLCQVLCALGNQLCALLGADSDVETPSNFGKYLESFLAFT
THPSQFLRSSTQMTWGALFRHEILSRDPLLLAIIPKYLRASMTNLVKMGFPSKTDSPSCE
YSRFDFDSDEDFNAFFNSSRAQQGEVMRLACRLDPKTSFQMAGEWLKYQLSTFLDAGSVN
SCSAVGTGEGSLCSVFSPSFVQWEAMTLFLESVITQMFRTLNREEIPVNDGIELLQMVLN
FDTKDPLILSCVLTNVSALFPFVTYRPEFLPQVFSKLFSSVTFETVEESKAPRTRAVRNV
RRHACSSIIKMCRDYPQLVLPNFDMLYNHVKQLLSNELLLTQMEKCALMEALVLISNQFK
NYERQKVFLEELMAPVASIWLSQDMHRVLSDVDAFIAYVGTDQKSCDPGLEDPCGLNRAR
MSFCVYSILGVVKRTCWPTDLEEAKAGGFVVGYTSSGNPIFRNPCTEQILKLLDNLLALI
RTHNTLYAPEMLAKMAEPFTKALDMLDAEKSAILGLPQPLLELNDSPVFKTVLERMQRFF
STLYENCFHILGKAGPSMQQDFYTVEDLATQLLSSAFVNLNNIPDYRLRPMLRVFVKPLV
LFCPPEHYEALVSPILGPLFTYLHMRLSQKWQVINQRSLLCGEDEAADENPESQEMLEEQ
LVRMLTREVMDLITVCCVSKKGADHSSAPPADGDDEEMMATEVTPSAMAELTDLGKCLMK
HEDVCTALLITAFNSLAWKDTLSCQRTTSQLCWPLLKQVLSGTLLADAVTWLFTSVLKGL
QMHGQHDGCMASLVHLAFQIYEALRPRYLEIRAVMEQIPEIQKDSLDQFDCKLLNPSLQK
VADKRRKDQFKRLIAGCIGKPLGEQFRKEVHIKNLPSLFKKTKPMLETEVLDNDGGGLAT
IFEP
GenBank ID Protein 22748937
UniProtKB/Swiss-Prot ID Q9HAV4
UniProtKB/Swiss-Prot Entry Name XPO5_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_020750.2
GeneCard ID XPO5
GenAtlas ID XPO5
HGNC ID HGNC:17675
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  7. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  8. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  9. Nagase T, Ishikawa K, Kikuno R, Hirosawa M, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Oct 29;6(5):337-45. [PubMed:10574462 ]
  10. Bohnsack MT, Regener K, Schwappach B, Saffrich R, Paraskeva E, Hartmann E, Gorlich D: Exp5 exports eEF1A via tRNA from nuclei and synergizes with other transport pathways to confine translation to the cytoplasm. EMBO J. 2002 Nov 15;21(22):6205-15. [PubMed:12426392 ]
  11. Calado A, Treichel N, Muller EC, Otto A, Kutay U: Exportin-5-mediated nuclear export of eukaryotic elongation factor 1A and tRNA. EMBO J. 2002 Nov 15;21(22):6216-24. [PubMed:12426393 ]
  12. Brownawell AM, Macara IG: Exportin-5, a novel karyopherin, mediates nuclear export of double-stranded RNA binding proteins. J Cell Biol. 2002 Jan 7;156(1):53-64. Epub 2002 Jan 3. [PubMed:11777942 ]
  13. Yi R, Qin Y, Macara IG, Cullen BR: Exportin-5 mediates the nuclear export of pre-microRNAs and short hairpin RNAs. Genes Dev. 2003 Dec 15;17(24):3011-6. Epub 2003 Dec 17. [PubMed:14681208 ]
  14. Gwizdek C, Ossareh-Nazari B, Brownawell AM, Doglio A, Bertrand E, Macara IG, Dargemont C: Exportin-5 mediates nuclear export of minihelix-containing RNAs. J Biol Chem. 2003 Feb 21;278(8):5505-8. Epub 2002 Dec 30. [PubMed:12509441 ]
  15. Gwizdek C, Ossareh-Nazari B, Brownawell AM, Evers S, Macara IG, Dargemont C: Minihelix-containing RNAs mediate exportin-5-dependent nuclear export of the double-stranded RNA-binding protein ILF3. J Biol Chem. 2004 Jan 9;279(2):884-91. Epub 2003 Oct 21. [PubMed:14570900 ]
  16. Chen T, Brownawell AM, Macara IG: Nucleocytoplasmic shuttling of JAZ, a new cargo protein for exportin-5. Mol Cell Biol. 2004 Aug;24(15):6608-19. [PubMed:15254228 ]
  17. Bohnsack MT, Czaplinski K, Gorlich D: Exportin 5 is a RanGTP-dependent dsRNA-binding protein that mediates nuclear export of pre-miRNAs. RNA. 2004 Feb;10(2):185-91. [PubMed:14730017 ]
  18. Lund E, Guttinger S, Calado A, Dahlberg JE, Kutay U: Nuclear export of microRNA precursors. Science. 2004 Jan 2;303(5654):95-8. Epub 2003 Nov 20. [PubMed:14631048 ]
  19. Yi R, Doehle BP, Qin Y, Macara IG, Cullen BR: Overexpression of exportin 5 enhances RNA interference mediated by short hairpin RNAs and microRNAs. RNA. 2005 Feb;11(2):220-6. Epub 2004 Dec 21. [PubMed:15613540 ]