You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08621
Secondary Accession Numbers
  • 14336
Name Exportin-7
Synonyms
  1. Exp7
  2. Ran-binding protein 16
Gene Name XPO7
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Mediates the nuclear export of proteins (cargos) with broad substrate specificity. In the nucleus binds cooperatively to its cargo and to the GTPase Ran in its active GTP-bound form. Docking of this trimeric complex to the nuclear pore complex (NPC) is mediated through binding to nucleoporins. Upon transit of a nuclear export complex into the cytoplasm, disassembling of the complex and hydrolysis of Ran-GTP to Ran-GDP (induced by RANBP1 and RANGAP1, respectively) cause release of the cargo from the export receptor. XPO7 then return to the nuclear compartment and mediate another round of transport. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein transporter activity
transporter activity
substrate-specific transporter activity
Process
establishment of localization
transport
protein transport
intracellular protein transport
Cellular Location
  1. Nucleus
  2. Cytoplasm (Probable)
  3. Nucleus (Probable)
  4. nuclear pore complex (Probable)
Gene Properties
Chromosome Location Chromosome:8
Locus 8p21
SNPs XPO7
Gene Sequence
>3264 bp
ATGGCGGATCATGTGCAGAGCCTGGCCCAACTAGAGAATCTGTGCAAACAGCTGTATGAA
ACCACAGACACAACCACTCGACTCCAGGCAGAGAAAGCCTTGGTTGAATTTACCAACAGC
CCTGATTGCCTGAGCAAGTGCCAGCTACTCCTCGAAAGAGGAAGTTCCTCTTACTCCCAG
TTACTGGCAGCTACATGCCTTACCAAGCTTGTATCACGCACAAACAACCCCCTACCATTG
GAACAGCGAATAGATATTCGGAACTATGTGCTCAACTACCTTGCCACTCGGCCGAAGTTG
GCTACTTTCGTGACACAAGCACTTATTCAGTTATATGCCAGAATCACAAAACTGGGCTGG
TTTGACTGTCAGAAGGATGACTATGTCTTCAGAAATGCAATCACAGACGTCACAAGGTTT
TTACAGGATAGTGTTGAATACTGCATCATTGGTGTCACAATTTTATCTCAGCTAACCAAT
GAAATTAATCAAGCAGACACCACCCATCCTTTAACCAAGCACAGAAAAATAGCCTCTTCT
TTTCGCGATTCATCATTATTTGATATCTTCACACTTTCCTGCAATTTACTAAAACAGGCT
TCAGGAAAGAATCTAAACTTGAATGATGAAAGTCAGCATGGCTTGCTCATGCAACTGCTC
AAGCTCACTCATAACTGCCTCAACTTTGACTTCATCGGCACTTCCACTGATGAGTCCTCA
GACGACCTGTGTACAGTGCAGATTCCCACCAGCTGGAGATCAGCCTTCTTAGATTCTTCA
ACCTTGCAGCTGTTTTTTGACCTGTATCATTCCATCCCTCCTTCATTTTCACCTCTGGTA
TTATCCTGCTTGGTACAGATCGCTTCAGTCAGAAGATCCCTGTTTAACAATGCAGAGAGG
GCCAAGTTTCTCTCTCATCTTGTTGATGGTGTTAAACGAATACTGGAAAACCCACAGAGT
TTATCAGACCCAAACAATTACCATGAGTTTTGCAGACTACTGGCCCGATTGAAGAGTAAC
TATCAACTGGGAGAATTGGTAAAGGTGGAAAACTACCCTGAGGTCATCCGATTGATAGCC
AACTTCACAGTGACCAGCCTACAGCACTGGGAATTTGCTCCAAATAGTGTGCACTATCTT
CTGAGCCTGTGGCAGCGGCTGGCAGCCTCTGTGCCGTATGTCAAAGCCACAGAGCCCCAC
ATGCTGGAAACTTACACTCCTGAGGTCACCAAAGCCTACATCACATCCCGGTTGGAATCT
GTGCACATCATACTGAGAGATGGCCTGGAAGATCCCCTGGAGGATACGGGGCTGGTCCAG
CAGCAGTTGGACCAGCTGTCCACCATTGGGCGTTGTGAATATGAGAAGACGTGTGCACTC
CTCGTGCAGTTGTTTGACCAGTCGGCCCAGTCGTACCAGGAGCTGCTACAGAGCGCCAGC
GCAAGCCCAATGGACATTGCAGTGCAGGAGGGAAGGCTGACATGGCTGGTTTACATTATT
GGAGCAGTGATCGGTGGCCGGGTTTCTTTTGCCAGCACTGATGAGCAAGACGCCATGGAT
GGTGAGCTTGTCTGTCGGGTGCTCCAGCTGATGAACCTAACAGATTCTCGTTTGGCCCAG
GCGGGTAATGAGAAGCTAGAGTTGGCCATGCTGAGCTTTTTTGAACAGTTTCGTAAGATC
TACATTGGGGACCAAGTGCAGAAATCCTCTAAGCTGTACCGCCGACTCTCAGAAGTTCTG
GGCTTGAATGATGAGACCATGGTCCTAAGCGTCTTCATAGGAAAAATCATCACCAACTTG
AAGTACTGGGGCCGTTGTGAACCAATCACCTCCAAGACACTACAGCTTCTCAATGACCTG
TCCATTGGGTACAGTAGCGTAAGGAAGCTAGTGAAGCTTAGTGCGGTACAGTTCATGCTG
AACAATCACACGAGCGAGCACTTTTCATTTTTGGGTATTAACAATCAGTCCAACCTGACA
GACATGCGGTGTCGGACTACCTTCTACACAGCACTTGGGCGTCTCCTCATGGTGGATTTA
GGAGAGGATGAAGATCAGTATGAGCAGTTCATGCTGCCACTCACAGCAGCATTTGAGGCT
GTGGCCCAGATGTTTAGCACCAATAGTTTCAACGAGCAGGAGGCAAAGCGAACTCTAGTT
GGCCTAGTAAGAGACCTGAGAGGGATCGCTTTCGCTTTCAATGCCAAGACCAGCTTCATG
ATGCTCTTTGAATGGATATATCCATCCTATATGCCAATTCTCCAACGGGCAATTGAGCTC
TGGTACCATGATCCAGCCTGTACTACACCTGTACTCAAGTTGATGGCTGAATTGGTTCAT
AATAGGTCCCAGCGACTCCAGTTTGATGTCTCTTCCCCCAATGGCATCTTACTCTTCCGA
GAAACCAGCAAGATGATAACAATGTATGGCAATCGCATCCTGACACTAGGAGAGGTCCCA
AAGGATCAGGTCTATGCTCTGAAGCTCAAGGGCATCTCCATCTGCTTCTCCATGCTGAAG
GCTGCTCTCAGTGGGAGTTACGTCAATTTCGGAGTCTTTCGTCTCTATGGAGACGATGCC
CTGGACAATGCTCTGCAGACCTTCATCAAGCTGCTCCTCTCTATTCCTCACAGTGATCTC
TTGGATTACCCCAAGCTCAGCCAGTCTTATTATTCACTACTGGAAGTCCTGACCCAGGAC
CATATGAACTTTATTGCAAGCCTGGAACCTCACGTCATCATGTATATTCTCTCTTCCATT
TCTGAAGGACTTACTGCACTTGACACCATGGTATGCACAGGCTGCTGCTCCTGCCTGGAC
CACATTGTGACATACCTCTTCAAGCAGCTGTCACGTAGCACCAAGAAGAGGACCACACCC
CTGAACCAGGAGAGCGACCGCTTTCTGCACATCATGCAGCAGCATCCAGAGATGATCCAG
CAGATGCTGTCCACGGTGCTGAACATCATCATCTTTGAAGACTGTAGGAACCAGTGGTCT
ATGTCCCGACCACTACTTGGCTTGATATTGCTTAATGAAAAGTATTTTTCTGACCTAAGA
AACAGTATTGTGAACAGCCAGCCACCGGAGAAGCAGCAGGCCATGCACCTGTGTTTTGAG
AACCTGATGGAAGGCATCGAGCGAAATCTTCTTACGAAAAACAGAGACAGGTTCACCCAG
AACCTGTCAGCATTCCGTCGAGAAGTCAACGACTCAATGAAGAATTCCACTTATGGCGTG
AATAGCAATGACATGATGAGCTGA
Protein Properties
Number of Residues 1087
Molecular Weight 123906.1
Theoretical pI 6.27
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Exportin-7
MADHVQSLAQLENLCKQLYETTDTTTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQ
LLAATCLTKLVSRTNNPLPLEQRIDIRNYVLNYLATRPKLATFVTQALIQLYARITKLGW
FDCQKDDYVFRNAITDVTRFLQDSVEYCIIGVTILSQLTNEINQADTTHPLTKHRKIASS
FRDSSLFDIFTLSCNLLKQASGKNLNLNDESQHGLLMQLLKLTHNCLNFDFIGTSTDESS
DDLCTVQIPTSWRSAFLDSSTLQLFFDLYHSIPPSFSPLVLSCLVQIASVRRSLFNNAER
AKFLSHLVDGVKRILENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPEVIRLIA
NFTVTSLQHWEFAPNSVHYLLSLWQRLAASVPYVKATEPHMLETYTPEVTKAYITSRLES
VHIILRDGLEDPLEDTGLVQQQLDQLSTIGRCEYEKTCALLVQLFDQSAQSYQELLQSAS
ASPMDIAVQEGRLTWLVYIIGAVIGGRVSFASTDEQDAMDGELVCRVLQLMNLTDSRLAQ
AGNEKLELAMLSFFEQFRKIYIGDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKIITNL
KYWGRCEPITSKTLQLLNDLSIGYSSVRKLVKLSAVQFMLNNHTSEHFSFLGINNQSNLT
DMRCRTTFYTALGRLLMVDLGEDEDQYEQFMLPLTAAFEAVAQMFSTNSFNEQEAKRTLV
GLVRDLRGIAFAFNAKTSFMMLFEWIYPSYMPILQRAIELWYHDPACTTPVLKLMAELVH
NRSQRLQFDVSSPNGILLFRETSKMITMYGNRILTLGEVPKDQVYALKLKGISICFSMLK
AALSGSYVNFGVFRLYGDDALDNALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQD
HMNFIASLEPHVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFKQLSRSTKKRTTP
LNQESDRFLHIMQQHPEMIQQMLSTVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLR
NSIVNSQPPEKQQAMHLCFENLMEGIERNLLTKNRDRFTQNLSAFRREVNDSMKNSTYGV
NSNDMMS
GenBank ID Protein 154448892
UniProtKB/Swiss-Prot ID Q9UIA9
UniProtKB/Swiss-Prot Entry Name XPO7_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_015024.4
GeneCard ID XPO7
GenAtlas ID XPO7
HGNC ID HGNC:14108
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  3. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  4. Nagase T, Ishikawa K, Suyama M, Kikuno R, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Oct 30;5(5):277-86. [PubMed:9872452 ]
  5. Koch P, Bohlmann I, Schafer M, Hansen-Hagge TE, Kiyoi H, Wilda M, Hameister H, Bartram CR, Janssen JW: Identification of a novel putative Ran-binding protein and its close homologue. Biochem Biophys Res Commun. 2000 Nov 11;278(1):241-9. [PubMed:11071879 ]
  6. Kutay U, Hartmann E, Treichel N, Calado A, Carmo-Fonseca M, Prehn S, Kraft R, Gorlich D, Bischoff FR: Identification of two novel RanGTP-binding proteins belonging to the importin beta superfamily. J Biol Chem. 2000 Dec 22;275(51):40163-8. [PubMed:11024021 ]
  7. Mingot JM, Bohnsack MT, Jakle U, Gorlich D: Exportin 7 defines a novel general nuclear export pathway. EMBO J. 2004 Aug 18;23(16):3227-36. Epub 2004 Jul 29. [PubMed:15282546 ]