You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08622
Secondary Accession Numbers
  • 14337
Name Exportin-T
Synonyms
  1. Exportin(tRNA)
  2. tRNA exportin
Gene Name XPOT
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Mediates the nuclear export of aminoacylated tRNAs. In the nucleus binds to tRNA and to the GTPase Ran in its active GTP- bound form. Docking of this trimeric complex to the nuclear pore complex (NPC) is mediated through binding to nucleoporins. Upon transit of a nuclear export complex into the cytoplasm, disassembling of the complex and hydrolysis of Ran-GTP to Ran-GDP (induced by RANBP1 and RANGAP1, respectively) cause release of the tRNA from the export receptor. XPOT then return to the nuclear compartment and mediate another round of transport. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein transporter activity
transporter activity
substrate-specific transporter activity
Process
establishment of localization
transport
protein transport
intracellular protein transport
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 12q14.2
SNPs XPOT
Gene Sequence
>2889 bp
ATGGATGAACAGGCTCTATTAGGGCTAAATCCAAATGCTGATTCAGACTTTAGACAAAGG
GCCCTGGCCTATTTTGAGCAGTTAAAAATTTCCCCAGATGCCTGGCAGGTGTGTGCAGAA
GCTCTAGCCCAGAGGACATACAGTGATGATCATGTGAAGTTTTTCTGCTTTCAAGTACTG
GAACATCAAGTTAAATACAAATACTCAGAACTAACCACTGTTCAACAACAGCTAATTAGG
GAGACGCTCATATCATGGCTGCAAGCTCAGATGCTGAATCCCCAACCAGAGAAGACCTTT
ATACGAAATAAAGCCGCCCAAGTCTTCGCCTTGCTTTTTGTTACAGAGTATCTCACTAAG
TGGCCCAAGTTTTTTTTTGACATTCTCTCAGTAGTGGACCTAAATCCAAGGGGAGTAGAT
CTCTACCTGCGAATCCTCATGGCTATTGATTCAGAGTTGGTGGATCGTGATGTGGTGCAT
ACATCAGAGGAGGCTCGTAGGAATACTCTCATAAAAGATACCATGAGGGAACAGTGCATT
CCAAATCTGGTGGAATCATGGTACCAAATATTACAAAATTATCAGTTTACTAATTCTGAA
GTGACGTGTCAGTGCCTTGAAGTAGTTGGGGCTTATGTCTCTTGGATAGACTTATCCCTT
ATAGCCAATGATAGGTTTATAAATATGCTGCTAGGTCATATGTCAATAGAAGTTCTACGG
GAAGAAGCATGTGACTGTTTATTTGAAGTTGTAAATAAAGGAATGGACCCTGTTGATAAA
ATGAAACTAGTGGAATCTTTGTGTCAAGTATTACAGTCTGCTGGGTTTTTCAGCATTGAC
CAGGAAGAAGATGTTGACTTCCTGGCCAGATTTTCTAAGTTGGTAAATGGAATGGGACAG
TCATTGATAGTTAGTTGGAGTAAATTAATTAAGAATGGGGATATTAAGAATGCTCAAGAG
GCACTACAAGCTATTGAAACAAAAGTGGCACTGATGTTGCAGCTACTAATTCATGAGGAT
GATGATATTTCTTCTAATATTATTGGATTTTGTTACGATTATCTTCATATTTTGAAACAG
CTTACAGTGCTCTCGGATCAGCAAAAAGCTAATGTAGAGGCAATCATGTTGGCCGTTATG
AAAAAATTGACTTACGATGAAGAATATAACTTTGAAAATGAGGGTGAAGATGAAGCCATG
TTTGTAGAATATAGAAAACAACTGAAGTTACTGTTGGACAGGCTTGCTCAAGTTTCACCA
GAGTTACTACTGGCCTCTGTTCGCAGAGTTTTTAGTTCTACACTGCAGAATTGGCAGACT
ACACGGTTTATGGAAGTTGAAGTAGCAATAAGATTGCTGTATATGTTGGCAGAAGCTCTT
CCAGTATCTCATGGTGCTCACTTCTCAGGTGATGTTTCAAAAGCTAGTGCTTTGCAGGAT
ATGATGCGAACTCTGGTAACATCAGGAGTCAGTTCCTATCAGCATACATCTGTGACATTG
GAGTTCTTCGAAACTGTTGTTAGATATGAAAAGTTTTTCACAGTTGAACCTCAGCACATT
CCATGTGTACTAATGGCTTTCTTAGATCACAGAGGTCTGCGGCATTCCAGTGCAAAAGTT
CGGAGCAGGACGGCTTACCTGTTTTCTAGATTTGTCAAATCTCTCAATAAGCAAATGAAT
CCTTTCATTGAGGATATTTTGAATAGAATACAAGATTTATTAGAGCTTTCTCCACCTGAG
AATGGCCACCAGTCCTTACTGAGCAGCGATGATCAACTTTTTATTTATGAGACAGCTGGA
GTGCTGATTGTTAATAGTGAATATCCGGCAGAAAGGAAACAAGCCTTAATGAGGAATCTG
TTGACTCCACTAATGGAGAAGTTTAAAATTCTGTTAGAAAAGTTGATGCTGGCACAAGAT
GAAGAAAGGCAAGCCTCTCTAGCAGACTGTCTTAACCATGCTGTTGGATTTGCAAGTCGA
ACCAGTAAAGCTTTCAGCAACAAACAGACTGTGAAACAATGTGGCTGTTCCGAAGTTTAT
CTGGACTGTTTACAGACATTCTTGCCAGCCCTCAGTTGTCCCTTACAAAAGGATATTCTC
AGAAGTGGAGTCCGTACTTTCCTTCATCGAATGATTATTTGCCTGGAGGAAGAAGTTCTT
CCGTTCATTCCATCTGCTTCAGAACATATGCTCAAAGATTGTGAAGCAAAAGATCTCCAG
GAGTTCATTCCTCTTATCAACCAGATTACGGCCAAATTCAAGATACAGGTATCCCCGTTT
TTACAACAGATGTTCATGCCCCTGCTTCATGCAATTTTTGAAGTGCTGCTCCGGCCAGCA
GAAGAAAATGACCAGTCTGCTGCTTTAGAGAAGCAGATGTTGCGGAGGAGTTACTTTGCT
TTCCTGCAAACAGTCACAGGCAGTGGGATGAGCGAAGTTATAGCAAATCAAGGTGCAGAG
AATGTAGAAAGAGTGTTGGTTACTGTTATCCAAGGAGCAGTTGAATATCCAGATCCAATT
GCACAGAAAACATGTTTTATCATCCTCTCAAAGTTGGTAGAACTCTGGGGAGGTAAAGAT
GGACCAGTGGGATTTGCTGATTTTGTTTATAAGCACATTGTCCCCGCATGTTTCCTAGCA
CCTTTAAAACAAACCTTTGACCTGGCAGATGCACAAACAGTATTGGCTTTATCTGAGTGT
GCAGTGACACTGAAAACAATTCATCTCAAACGGGGCCCAGAATGTGTTCAGTATCTTCAA
CAAGAATACCTGCCCTCCTTGCAAGTAGCTCCAGAAATAATTCAGGAGTTTTGTCAAGCG
CTTCAGCAGCCTGATGCTAAAGTTTTTAAAAATTACTTAAAGGTGTTCTTCCAGAGAGCA
AAGCCCTGA
Protein Properties
Number of Residues 962
Molecular Weight 109963.2
Theoretical pI 5.05
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Exportin-T
MDEQALLGLNPNADSDFRQRALAYFEQLKISPDAWQVCAEALAQRTYSDDHVKFFCFQVL
EHQVKYKYSELTTVQQQLIRETLISWLQAQMLNPQPEKTFIRNKAAQVFALLFVTEYLTK
WPKFFFDILSVVDLNPRGVDLYLRILMAIDSELVDRDVVHTSEEARRNTLIKDTMREQCI
PNLVESWYQILQNYQFTNSEVTCQCLEVVGAYVSWIDLSLIANDRFINMLLGHMSIEVLR
EEACDCLFEVVNKGMDPVDKMKLVESLCQVLQSAGFFSIDQEEDVDFLARFSKLVNGMGQ
SLIVSWSKLIKNGDIKNAQEALQAIETKVALMLQLLIHEDDDISSNIIGFCYDYLHILKQ
LTVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLLLDRLAQVSP
ELLLASVRRVFSSTLQNWQTTRFMEVEVAIRLLYMLAEALPVSHGAHFSGDVSKASALQD
MMRTLVTSGVSSYQHTSVTLEFFETVVRYEKFFTVEPQHIPCVLMAFLDHRGLRHSSAKV
RSRTAYLFSRFVKSLNKQMNPFIEDILNRIQDLLELSPPENGHQSLLSSDDQLFIYETAG
VLIVNSEYPAERKQALMRNLLTPLMEKFKILLEKLMLAQDEERQASLADCLNHAVGFASR
TSKAFSNKQTVKQCGCSEVYLDCLQTFLPALSCPLQKDILRSGVRTFLHRMIICLEEEVL
PFIPSASEHMLKDCEAKDLQEFIPLINQITAKFKIQVSPFLQQMFMPLLHAIFEVLLRPA
EENDQSAALEKQMLRRSYFAFLQTVTGSGMSEVIANQGAENVERVLVTVIQGAVEYPDPI
AQKTCFIILSKLVELWGGKDGPVGFADFVYKHIVPACFLAPLKQTFDLADAQTVLALSEC
AVTLKTIHLKRGPECVQYLQQEYLPSLQVAPEIIQEFCQALQQPDAKVFKNYLKVFFQRA
KP
GenBank ID Protein 8051636
UniProtKB/Swiss-Prot ID O43592
UniProtKB/Swiss-Prot Entry Name XPOT_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_007235.3
GeneCard ID XPOT
GenAtlas ID XPOT
HGNC ID HGNC:12826
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075 ]
  5. Kutay U, Lipowsky G, Izaurralde E, Bischoff FR, Schwarzmaier P, Hartmann E, Gorlich D: Identification of a tRNA-specific nuclear export receptor. Mol Cell. 1998 Feb;1(3):359-69. [PubMed:9660920 ]
  6. Arts GJ, Fornerod M, Mattaj IW: Identification of a nuclear export receptor for tRNA. Curr Biol. 1998 Mar 12;8(6):305-14. [PubMed:9512417 ]
  7. Arts GJ, Kuersten S, Romby P, Ehresmann B, Mattaj IW: The role of exportin-t in selective nuclear export of mature tRNAs. EMBO J. 1998 Dec 15;17(24):7430-41. [PubMed:9857198 ]
  8. Kuersten S, Arts GJ, Walther TC, Englmeier L, Mattaj IW: Steady-state nuclear localization of exportin-t involves RanGTP binding and two distinct nuclear pore complex interaction domains. Mol Cell Biol. 2002 Aug;22(16):5708-20. [PubMed:12138183 ]