You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08625
Secondary Accession Numbers
  • 14340
Name Putative tubulin beta chain-like protein ENSP00000290377
Synonyms Not Available
Gene Name Not Available
Protein Type Unknown
Biological Properties
General Function Involved in structural molecule activity
Specific Function Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain
Pathways Not Available
Reactions Not Available
GO Classification
Component
macromolecular complex
protein complex
microtubule
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
structural molecule activity
gtpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Process
cellular process
cellular component organization or biogenesis
cellular component organization
cellular component assembly
macromolecular complex assembly
cellular protein complex assembly
microtubule-based process
microtubule-based movement
protein complex assembly
protein polymerization
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs Not Available
Gene Sequence
>1119 bp
ATGGACTCTGTGCGCTCGGGGCCCTTCGGGCAGGTCTTCAGGCCAGACAACTTCATCTTC
GGTCAGTGTGGGGCCGGAAACAACTGGGCCAAGGGACACTACACCGAAGGCGCGGAGCTG
ATGGAGTCAGTGATGGACGTTGTCAGAAAGGAGGCTGAGAGCTGTGACTGCCTGCAGGGT
TTCCAGCTGACCCACTCCCTGGGTGGGGGGACTGGGTCTGGGATGGGTACCCTTCTGCTC
AGTAAGATCCGGGAGGAGTACCCAGACAGGATCATAAACACATTCAGCATCCTGCCCTCG
CCCAAGGTGTCGGACACCGTGGTGGAGCCCTACAACGCCACCCTCTCAGTCCACCAGCTC
ATAGAAAACGCAGATGAGACCTTTTGCATAGATAACGAAGCTCTGTATGACATATGTTCC
AAGACCCTAAAACTGCCCACACCCACCTATGGTGACCTGAACCACCTGGTGTCTGCTACC
ATGAGTGGGGTCACCACGTGCCTGCGCTTCCCGGGCCAGCTGAATGCTGACCTGCGGAAG
CTGGCCGTGAACATGGTCCCGTTTCCCCGGCTGCATTTCTTCATGCCCGGCTTTGCCCCA
CTGACCAGCCGGGGCAGCCAGCAGTACCGGGCCTTGACTGTGGCTGAGCTTACCCAGCAG
ATGTTTGATGCTAAGAACATGATGGCTGCCTGTGACCCCCGTCACGGCCGCTACCTAACG
GCGGCTGCCATTTTCAGGGGTCGCATGCCCATGAGGGAGGTGGATGAACAAATGTTCAAC
ATTCAAGATAAGAACAGCAGTTACTTTGCTGACTGGCTCCCCAACAACGTAAAAACAGCC
GTCTGTGACATCCCACCCCGGGGGCTAAAAATGTCAGCCACCTTCATTGGGAATAATACG
GCCATCCAGGAACTCTTCAAGCGTGTCTCAGAGCAGTTTACAGCAATGTTCAGGCGCAAG
GCCTTCCTCCACTGGTACACGGGCGAGGGCATGGATGAGATGGAATTCACCGAGGCCGAG
AGCAACATGAACGACCTGGTGTCTGAATATCAGCAATATCAGGATGCCACGGCCGAGGAG
GAGGAGGATGAGGAGTATGCCGAGGAGGAGGTGGCCTAG
Protein Properties
Number of Residues 372
Molecular Weight 41774.7
Theoretical pI 4.5
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Putative tubulin beta chain-like protein ENSP00000290377
MDSVRSGPFGQVLRPDNFIFGQCGAGNNWAKGRYTEGAELTESVMDVVRKEAESCDCLQG
FQLTHSLGGGTGSGMVTLLISKIREEYPDRIINTFSILPSPKVSDTVVEPYNATLSVHQL
IENADETFCIDNEALYDICSKTLKLPTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRK
LAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTQQMFDAKNMRAARDPRHGRYLT
AAAIFQGRMPMREVDEQMFNIQDKNSSYFADWFPDNVKTAICDIPPRGLKMSASFIGNNA
AIQELFTCVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAKE
EEDEEYAEEEVA
GenBank ID Protein 255918171
UniProtKB/Swiss-Prot ID A6NKZ8
UniProtKB/Swiss-Prot Entry Name YI016_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001164154
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]