You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08628
Secondary Accession Numbers
  • 14343
Name ATP-binding cassette sub-family B member 10, mitochondrial
Synonyms
  1. ABC transporter 10 protein
  2. ATP-binding cassette transporter 10
  3. M-ABC2
  4. Mitochondrial ATP-binding cassette 2
Gene Name ABCB10
Protein Type Unknown
Biological Properties
General Function Involved in ATP binding
Specific Function May mediate critical mitochondrial transport functions related to heme biosynthesis
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
active transmembrane transporter activity
primary active transmembrane transporter activity
p-p-bond-hydrolysis-driven transmembrane transporter activity
atpase activity, coupled to transmembrane movement of substances
binding
nucleotide binding
catalytic activity
hydrolase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
transmembrane transporter activity
atpase activity
transporter activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Mitochondrion inner membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 1q42.13
SNPs ABCB10
Gene Sequence
>2217 bp
ATGCGAGGCCCCCCTGCCTGGCCGCTGCGGCTGCTCGAGCCACCGAGCCCTGCCGAGCCA
GGTCGGCTCCTGCCGGTAGCCTGCGTGTGGGCCGCGGCCAGCCGCGTTCCCGGGTCCCTA
TCGCCGTTCACTGGCCTGAGGCCGGCGCGGCTATGGGGCGCGGGGCCCGCGCTGCTCTGG
GGCGTTGGAGCCGCGCGCCGCTGGAGGAGCGGCTGCCGGGGCGGGGGTCCGGGCGCCTCG
CGGGGCGTCCTGGGCCTCGCGCGGCTCCTGGGGCTGTGGGCTCGCGGCCCCGGCAGCTGC
AGGTGCGGGGCTTTTGCCGGGCCAGGCGCTCCTCGGCTCCCGCGCGCCCGGTTCCCGGGC
GGTCCCGCAGCCGCTGCCTGGGCAGGGGACGAGGCCTGGCGGCGCGGGCCGGCGGCGCCT
CCCGGGGACAAGGGGCGGCTGCGCCCCGCAGCGGCCGGACTCCCGGAGGCCCGGAAGCTC
CTGGGGCTGGCGTACCCTGAGCGCCGGAGGCTGGCAGCTGCGGTTGGATTTCTCACGATG
TCCAGTGTTATCTCCATGTCTGCCCCTTTCTTCCTGGGGAAGATCATTGATGTCATCTAT
ACCAACCCCACTGTGGACTACAGCGACAACCTGACCCGCCTCTGCCTAGGGCTCAGTGCC
GTGTTTCTGTGTGGTGCTGCCGCCAATGCCATTCGTGTCTACCTCATGCAAACTTCAGGT
CAGCGCATTGTGAATAGGCTGAGAACTTCATTATTCTCCTCCATTCTGAGGCAGGAGGTT
GCTTTCTTTGACAAGACTCGCACAGGAGAATTGATTAACCGCCTCTCATCAGACACTGCA
CTCCTGGGGCGCTCAGTGACTGAAAACCTCTCAGATGGGCTCAGGGCCGGGGCCCAGGCT
TCCGTAGGCATCAGTATGATGTTTTTTGTCTCACCTAATCTGGCCACCTTTGTTTTGAGC
GTGGTGCCTCCAGTGTCAATCATTGCTGTAATTTATGGGCGATATCTACGGAAACTGACC
AAAGTCACTCAGGATTCCCTGGCACAAGCCACTCAGCTAGCTGAGGAACGTATTGGAAAT
GTAAGAACTGTTCGAGCTTTTGGGAAAGAAATGACTGAAATCGAGAAATATGCCAGCAAA
GTGGACCATGTAATGCAGTTAGCAAGGAAAGAGGCATTCGCCCGGGCTGGTTTCTTTGGA
GCAACTGGGCTCTCCGGAAACCTGATCGTGCTTTCTGTCCTGTACAAAGGAGGGCTGCTG
ATGGGCAGTGCCCACATGACCGTGGGTGAACTCTCTTCCTTCCTAATGTATGCTTTCTGG
GTTGGAATAAGCATTGGAGGTCTGAGCTCTTTCTACTCGGAGCTGATGAAAGGACTGGGT
GCAGGGGGGCGCCTCTGGGAGCTCCTGGAGAGAGAGCCCAAGCTGCCTTTTAACGAGGGG
GTCATCTTAAATGAGAAAAGCTTCCAGGGTGCTTTGGAGTTTAAGAACGTGCATTTTGCC
TATCCAGCTCGCCCAGAGGTGCCCATATTTCAGGATTTCAGCCTTTCCATTCCGTCAGGA
TCTGTCACGGCACTGGTTGGCCCAAGTGGTTCTGGCAAATCAACAGTGCTTTCACTCCTG
CTGAGGTTGTACGACCCTGCTTCTGGAACTATTAGTCTTGATGGCCATGACATCCGTCAG
CTAAACCCAGTGTGGCTGAGATCCAAAATTGGGACAGTGAGTCAGGAACCCATTTTGTTT
TCTTGCTCTATTGCTGAGAACATTGCTTATGGTGCTGATGACCCTTCCTCTGTGACCGCT
GAGGAAATCCAGAGAGTGGCTGAAGTGGCCAATGCAGTGGCCTTCATCCGGAATTTCCCC
CAAGGGTTCAACACTGTGGTTGGAGAAAAGGGTGTTCTCCTCTCAGGTGGGCAGAAACAG
CGGATTGCGATTGCCCGTGCTCTGCTAAAGAATCCCAAAATTCTTCTCCTAGATGAAGCA
ACCAGTGCGCTGGATGCCGAAAATGAGTACCTTGTTCAAGAAGCTCTAGATCGACTGATG
GATGGAAGAACGGTGTTAGTTATTGCCCATCGTCTGTCCACCATTAAGAATGCTAATATG
GTTGCTGTTCTTGACCAAGGAAAAATTACTGAATATGGAAAACATGAAGAGCTGCTTTCA
AAACCAAATGGGATATACAGAAAACTAATGAACAAACAAAGTTTTATTTCAGCATAA
Protein Properties
Number of Residues 738
Molecular Weight 79146.9
Theoretical pI 10.37
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 171-191
  • 216-236
  • 313-333
  • 408-428
  • 431-451
Protein Sequence
>ATP-binding cassette sub-family B member 10, mitochondrial
MRGPPAWPLRLLEPPSPAEPGRLLPVACVWAAASRVPGSLSPFTGLRPARLWGAGPALLW
GVGAARRWRSGCRGGGPGASRGVLGLARLLGLWARGPGSCRCGAFAGPGAPRLPRARFPG
GPAAAAWAGDEAWRRGPAAPPGDKGRLRPAAAGLPEARKLLGLAYPERRRLAAAVGFLTM
SSVISMSAPFFLGKIIDVIYTNPTVDYSDNLTRLCLGLSAVFLCGAAANAIRVYLMQTSG
QRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQA
SVGISMMFFVSPNLATFVLSVVPPVSIIAVIYGRYLRKLTKVTQDSLAQATQLAEERIGN
VRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGATGLSGNLIVLSVLYKGGLL
MGSAHMTVGELSSFLMYAFWVGISIGGLSSFYSELMKGLGAGGRLWELLEREPKLPFNEG
VILNEKSFQGALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTALVGPSGSGKSTVLSLL
LRLYDPASGTISLDGHDIRQLNPVWLRSKIGTVSQEPILFSCSIAENIAYGADDPSSVTA
EEIQRVAEVANAVAFIRNFPQGFNTVVGEKGVLLSGGQKQRIAIARALLKNPKILLLDEA
TSALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANMVAVLDQGKITEYGKHEELLS
KPNGIYRKLMNKQSFISA
GenBank ID Protein 171184400
UniProtKB/Swiss-Prot ID Q9NRK6
UniProtKB/Swiss-Prot Entry Name ABCBA_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_012089.2
GeneCard ID ABCB10
GenAtlas ID ABCB10
HGNC ID HGNC:41
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  5. Saito S, Iida A, Sekine A, Miura Y, Ogawa C, Kawauchi S, Higuchi S, Nakamura Y: Three hundred twenty-six genetic variations in genes encoding nine members of ATP-binding cassette, subfamily B (ABCB/MDR/TAP), in the Japanese population. J Hum Genet. 2002;47(1):38-50. [PubMed:11829140 ]
  6. Zhang F, Hogue DL, Liu L, Fisher CL, Hui D, Childs S, Ling V: M-ABC2, a new human mitochondrial ATP-binding cassette membrane protein. FEBS Lett. 2000 Jul 28;478(1-2):89-94. [PubMed:10922475 ]
  7. Allikmets R, Gerrard B, Glavac D, Ravnik-Glavac M, Jenkins NA, Gilbert DJ, Copeland NG, Modi W, Dean M: Characterization and mapping of three new mammalian ATP-binding transporter genes from an EST database. Mamm Genome. 1995 Feb;6(2):114-7. [PubMed:7766993 ]
  8. Graf SA, Haigh SE, Corson ED, Shirihai OS: Targeting, import, and dimerization of a mammalian mitochondrial ATP binding cassette (ABC) transporter, ABCB10 (ABC-me). J Biol Chem. 2004 Oct 8;279(41):42954-63. Epub 2004 Jun 23. [PubMed:15215243 ]