You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08633
Secondary Accession Numbers
  • 14349
Name Hsp90 co-chaperone Cdc37
Synonyms
  1. Hsp90 chaperone protein kinase-targeting subunit
  2. p50Cdc37
Gene Name CDC37
Protein Type Unknown
Biological Properties
General Function Involved in heat shock protein binding
Specific Function Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.2
SNPs CDC37
Gene Sequence
>1137 bp
ATGGTGGACTACAGCGTGTGGGACCACATTGAGGTGTCTGATGATGAAGACGAGACGCAC
CCCAACATCGACACGGCCAGTCTCTTCCGCTGGCGGCATCAGGCCCGGGTGGAACGCATG
GAGCAGTTCCAGAAGGAGAAGGAGGAACTGGACAGGGGCTGCCGCGAGTGCAAGCGCAAG
GTGGCCGAGTGCCAGAGGAAACTGAAGGAGCTGGAGGTGGCCGAGGGCGGCAAGGCAGAG
CTGGAGCGCCTGCAGGCCGAGGCACAGCAGCTGCGCAAGGAGGAGCGGAGCTGGGAGCAG
AAGCTGGAGGAGATGCGCAAGAAGGAGAAGAGCATGCCCTGGAACGTGGACACGCTCAGC
AAAGACGGCTTCAGCAAGAGCATGGTAAATACCAAGCCCGAGAAGACGGAGGAGGACTCA
GAGGAGGTGAGGGAGCAGAAACACAAGACCTTCGTGGAAAAATACGAGAAACAGATCAAG
CACTTTGGCATGCTTCGCCGCTGGGATGACAGCCAAAAGTACCTGTCAGACAACGTCCAC
CTGGTGTGCGAGGAGACAGCCAATTACCTGGTCATTTGGTGCATTGACCTAGAGGTGGAG
GAGAAATGTGCACTCATGGAGCAGGTGGCCCACCAGACAATCGTCATGCAATTTATCCTG
GAGCTGGCCAAGAGCCTAAAGGTGGACCCCCGGGCCTGCTTCCGGCAGTTCTTCACTAAG
ATTAAGACAGCCGATCGCCAGTACATGGAGGGCTTCAACGACGAGCTGGAAGCCTTCAAG
GAGCGTGTGCGGGGCCGTGCCAAGCTGCGCATCGAGAAGGCCATGAAGGAGTACGAGGAG
GAGGAGCGCAAGAAGCGGCTCGGCCCCGGCGGCCTGGACCCCGTCGAGGTCTACGAGTCC
CTCCCTGAGGAACTCCAGAAGTGCTTCGATGTGAAGGACGTGCAGATGCTGCAGGACGCC
ATCAGCAAGATGGACCCCACCGACGCAAAGTACCACATGCAGCGCTGCATTGACTCTGGC
CTCTGGGTCCCCAACTCTAAGGCCAGCGAGGCCAAGGAGGGAGAGGAGGCAGGTCCTGGG
GACCCATTACTGGAAGCTGTTCCCAAGACGGGCGATGAGAAGGATGTCAGTGTGTGA
Protein Properties
Number of Residues 378
Molecular Weight 44468.0
Theoretical pI 4.9
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Hsp90 co-chaperone Cdc37
MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRK
VAECQRKLKELEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLS
KDGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVH
LVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTK
IKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPVEVYES
LPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKASEAKEGEEAGPG
DPLLEAVPKTGDEKDVSV
GenBank ID Protein 57165048
UniProtKB/Swiss-Prot ID Q16543
UniProtKB/Swiss-Prot Entry Name CDC37_HUMAN
PDB IDs
GenBank Gene ID AY864824
GeneCard ID CDC37
GenAtlas ID CDC37
HGNC ID HGNC:1735
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [PubMed:15592455 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Jakobs A, Himstedt F, Funk M, Korn B, Gaestel M, Niedenthal R: Ubc9 fusion-directed SUMOylation identifies constitutive and inducible SUMOylation. Nucleic Acids Res. 2007;35(17):e109. Epub 2007 Aug 20. [PubMed:17709345 ]
  7. Stepanova L, Leng X, Parker SB, Harper JW: Mammalian p50Cdc37 is a protein kinase-targeting subunit of Hsp90 that binds and stabilizes Cdk4. Genes Dev. 1996 Jun 15;10(12):1491-502. [PubMed:8666233 ]
  8. Dai K, Kobayashi R, Beach D: Physical interaction of mammalian CDC37 with CDK4. J Biol Chem. 1996 Sep 6;271(36):22030-4. [PubMed:8703009 ]
  9. Lamphere L, Fiore F, Xu X, Brizuela L, Keezer S, Sardet C, Draetta GF, Gyuris J: Interaction between Cdc37 and Cdk4 in human cells. Oncogene. 1997 Apr 24;14(16):1999-2004. [PubMed:9150368 ]
  10. Hartson SD, Irwin AD, Shao J, Scroggins BT, Volk L, Huang W, Matts RL: p50(cdc37) is a nonexclusive Hsp90 cohort which participates intimately in Hsp90-mediated folding of immature kinase molecules. Biochemistry. 2000 Jun 27;39(25):7631-44. [PubMed:10858314 ]
  11. Shao J, Grammatikakis N, Scroggins BT, Uma S, Huang W, Chen JJ, Hartson SD, Matts RL: Hsp90 regulates p50(cdc37) function during the biogenesis of the activeconformation of the heme-regulated eIF2 alpha kinase. J Biol Chem. 2001 Jan 5;276(1):206-14. [PubMed:11036079 ]
  12. Rao J, Lee P, Benzeno S, Cardozo C, Albertus J, Robins DM, Caplan AJ: Functional interaction of human Cdc37 with the androgen receptor but not with the glucocorticoid receptor. J Biol Chem. 2001 Feb 23;276(8):5814-20. Epub 2000 Nov 20. [PubMed:11085988 ]