Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08636
Secondary Accession Numbers
  • 14352
Name Cytochrome P450 26B1
Synonyms
  1. Cytochrome P450 26A2
  2. Cytochrome P450 retinoic acid-inactivating 2
  3. Cytochrome P450RAI-2
  4. Retinoic acid-metabolizing cytochrome
Gene Name CYP26B1
Protein Type Unknown
Biological Properties
General Function Involved in monooxygenase activity
Specific Function Plays a key role in retinoic acid metabolism. Involved in the specific inactivation of all-trans-retinoic acid (RA). Responsible for generation of several hydroxylated forms of RA, including 4-OH-RA, 4-oxo-RA, and 18-OH-RA
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
electron carrier activity
iron ion binding
monooxygenase activity
heme binding
oxidoreductase activity
Cellular Location
  1. Peripheral membrane protein
  2. Peripheral membrane protein
  3. Endoplasmic reticulum membrane
  4. Microsome membrane
Gene Properties
Chromosome Location Chromosome:2
Locus 2p13.2
SNPs CYP26B1
Gene Sequence
>1539 bp
ATGCTCTTTGAGGGCTTGGATCTGGTGTCGGCGCTGGCCACCCTCGCCGCGTGCCTGGTG
TCCGTGACGCTGCTGCTGGCCGTGTCGCAGCAGCTGTGGCAGCTGCGCTGGGCCGCCACT
CGCGACAAGAGCTGCAAGCTGCCCATCCCCAAGGGATCCATGGGCTTCCCGCTCATCGGA
GAGACCGGCCACTGGCTGCTGCAGGGTTCTGGCTTCCAGTCGTCGCGGAGGGAGAAGTAT
GGCAACGTGTTCAAGACGCATTTGTTGGGGCGGCCGCTGATACGCGTGACCGGCGCGGAG
AACGTGCGCAAGATCCTCATGGGCGAGCACCACCTCGTGAGCACCGAGTGGCCTCGCAGC
ACCCGCATGTTGCTGGGCCCCAACACGGTGTCCAATTCCATTGGCGACATCCACCGCAAC
AAGCGCAAGGTCTTCTCCAAGATCTTCAGCCACGAGGCCCTGGAGAGTTACCTGCCCAAG
ATCCAGCTGGTGATCCAGGACACACTGCGCGCCTGGAGCAGCCACCCCGAGGCCATCAAC
GTGTACCAGGAGGCGCAGAAGCTGACCTTCCGCATGGCCATCCGGGTGCTGCTGGGCTTC
AGCATCCCTGAGGAGGACCTTGGGCACCTCTTTGAGGTCTACCAGCAGTTTGTGGACAAT
GTCTTCTCCCTGCCTGTCGACCTGCCCTTCAGTGGCTACCGGCGGGGCATTCAGGCTCGG
CAGATCCTGCAGAAGGGGCTGGAGAAGGCCATCCGGGAGAAGCTGCAGTGCACACAGGGC
AAGGACTACTTGGACGCCCTGGACCTCCTCATTGAGAGCAGCAAGGAGCACGGGAAGGAG
ATGACCATGCAGGAGCTGAAGGACGGGACCCTGGAGCTGATCTTTGCGGCCTATGCCACC
ACGGCCAGCGCCAGCACCTCACTCATCATGCAGCTGCTGAAGCACCCCACTGTGCTGGAG
AAGCTGCGGGATGAGCTGCGGGCTCATGGCATCCTGCACAGTGGCGGCTGCCCCTGCGAG
GGCACACTGCGCCTGGACACGCTCAGTGGGCTGCGCTACCTGGACTGCGTCATCAAGGAG
GTCATGCGCCTGTTCACGCCCATTTCCGGCGGCTACCGCACTGTGCTGCAGACCTTCGAG
CTTGATGGTTTCCAGATCCCCAAAGGCTGGAGTGTCATGTATAGCATCCGGGACACCCAT
GACACAGCGCCCGTGTTCAAAGACGTGAACGTGTTCGACCCCGATCGCTTCAGCCAGGCG
CGGAGCGAGGACAAGGATGGCCGCTTCCATTACCTCCCGTTCGGTGGCGGTGTCCGGACC
TGCCTGGGCAAGCACCTGGCCAAGCTGTTCCTGAAGGTGCTGGCGGTGGAGCTGGCTAGC
ACCAGCCGCTTTGAGCTGGCCACACGGACCTTCCCCCGCATCACCTTGGTCCCCGTCCTG
CACCCCGTGGATGGCCTCAGCGTCAAGTTCTTTGGCCTGGACTCCAACCAGAACGAGATC
CTGCCGGAGACGGAGGCCATGCTGAGCGCCACAGTCTAA
Protein Properties
Number of Residues 512
Molecular Weight 57512.1
Theoretical pI 8.63
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cytochrome P450 26B1
MLFEGLDLVSALATLAACLVSVTLLLAVSQQLWQLRWAATRDKSCKLPIPKGSMGFPLIG
ETGHWLLQGSGFQSSRREKYGNVFKTHLLGRPLIRVTGAENVRKILMGEHHLVSTEWPRS
TRMLLGPNTVSNSIGDIHRNKRKVFSKIFSHEALESYLPKIQLVIQDTLRAWSSHPEAIN
VYQEAQKLTFRMAIRVLLGFSIPEEDLGHLFEVYQQFVDNVFSLPVDLPFSGYRRGIQAR
QILQKGLEKAIREKLQCTQGKDYLDALDLLIESSKEHGKEMTMQELKDGTLELIFAAYAT
TASASTSLIMQLLKHPTVLEKLRDELRAHGILHSGGCPCEGTLRLDTLSGLRYLDCVIKE
VMRLFTPISGGYRTVLQTFELDGFQIPKGWSVMYSIRDTHDTAPVFKDVNVFDPDRFSQA
RSEDKDGRFHYLPFGGGVRTCLGKHLAKLFLKVLAVELASTSRFELATRTFPRITLVPVL
HPVDGLSVKFFGLDSNQNEILPETEAMLSATV
GenBank ID Protein 62822141
UniProtKB/Swiss-Prot ID Q9NR63
UniProtKB/Swiss-Prot Entry Name CP26B_HUMAN
PDB IDs Not Available
GenBank Gene ID AC007002
GeneCard ID CYP26B1
GenAtlas ID CYP26B1
HGNC ID HGNC:20581
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. White JA, Ramshaw H, Taimi M, Stangle W, Zhang A, Everingham S, Creighton S, Tam SP, Jones G, Petkovich M: Identification of the human cytochrome P450, P450RAI-2, which is predominantly expressed in the adult cerebellum and is responsible for all-trans-retinoic acid metabolism. Proc Natl Acad Sci U S A. 2000 Jun 6;97(12):6403-8. [PubMed:10823918 ]