Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08643
Secondary Accession Numbers
  • 14362
Name Cytoglobin
Synonyms
  1. HGb
  2. Histoglobin
  3. Stellate cell activation-associated protein
Gene Name CYGB
Protein Type Unknown
Biological Properties
General Function Involved in iron ion binding
Specific Function May have a protective function during conditions of oxidative stress. May be involved in intracellular oxygen storage or transfer
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
iron ion binding
heme binding
oxygen binding
Process
establishment of localization
transport
gas transport
oxygen transport
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 17q25.3
SNPs CYGB
Gene Sequence
>573 bp
ATGGAGAAAGTGCCAGGCGAGATGGAGATCGAGCGCAGGGAGCGGAGCGAGGAGCTGTCC
GAGGCGGAGAGGAAGGCGGTGCAGGCTATGTGGGCCCGGCTCTATGCCAACTGCGAGGAC
GTGGGGGTGGCCATCCTGGTGAGGTTCTTTGTGAACTTCCCCTCGGCCAAGCAGTACTTC
AGCCAGTTCAAGCACATGGAGGATCCCCTGGAGATGGAGCGGAGCCCCCAGCTGCGGAAG
CACGCCTGCCGAGTCATGGGGGCCCTCAACACTGTCGTGGAGAACCTGCATGACCCCGAC
AAGGTGTCCTCTGTGCTCGCCCTTGTGGGGAAAGCCCACGCCCTCAAGCACAAGGTGGAA
CCGGTGTACTTCAAGATCCTCTCTGGGGTCATTCTGGAGGTGGTCGCCGAGGAATTTGCC
AGTGACTTCCCACCTGAGACGCAGAGAGCCTGGGCCAAGCTGCGTGGCCTCATCTACAGC
CACGTGACCGCTGCCTACAAGGAAGTGGGCTGGGTGCAGCAGGTCCCCAACGCCACCACC
CCACCGGCCACACTGCCCTCTTCGGGGCCGTAG
Protein Properties
Number of Residues 190
Molecular Weight 21404.5
Theoretical pI 6.8
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cytoglobin
MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYF
SQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVE
PVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATT
PPATLPSSGP
GenBank ID Protein 19910939
UniProtKB/Swiss-Prot ID Q8WWM9
UniProtKB/Swiss-Prot Entry Name CYGB_HUMAN
PDB IDs
GenBank Gene ID AB057769
GeneCard ID CYGB
GenAtlas ID CYGB
HGNC ID HGNC:16505
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Burmester T, Ebner B, Weich B, Hankeln T: Cytoglobin: a novel globin type ubiquitously expressed in vertebrate tissues. Mol Biol Evol. 2002 Apr;19(4):416-21. [PubMed:11919282 ]
  4. Asahina K, Kawada N, Kristensen DB, Nakatani K, Seki S, Shiokawa M, Tateno C, Obara M, Yoshizato K: Characterization of human stellate cell activation-associated protein and its expression in human liver. Biochim Biophys Acta. 2002 Sep 27;1577(3):471-5. [PubMed:12359339 ]
  5. Trent JT 3rd, Hargrove MS: A ubiquitously expressed human hexacoordinate hemoglobin. J Biol Chem. 2002 May 31;277(22):19538-45. Epub 2002 Mar 13. [PubMed:11893755 ]
  6. de Sanctis D, Dewilde S, Pesce A, Moens L, Ascenzi P, Hankeln T, Burmester T, Bolognesi M: Mapping protein matrix cavities in human cytoglobin through Xe atom binding. Biochem Biophys Res Commun. 2004 Apr 16;316(4):1217-21. [PubMed:15044115 ]
  7. de Sanctis D, Dewilde S, Pesce A, Moens L, Ascenzi P, Hankeln T, Burmester T, Bolognesi M: Crystal structure of cytoglobin: the fourth globin type discovered in man displays heme hexa-coordination. J Mol Biol. 2004 Feb 27;336(4):917-27. [PubMed:15095869 ]
  8. Sugimoto H, Makino M, Sawai H, Kawada N, Yoshizato K, Shiro Y: Structural basis of human cytoglobin for ligand binding. J Mol Biol. 2004 Jun 11;339(4):873-85. [PubMed:15165856 ]
  9. Makino M, Sugimoto H, Sawai H, Kawada N, Yoshizato K, Shiro Y: High-resolution structure of human cytoglobin: identification of extra N- and C-termini and a new dimerization mode. Acta Crystallogr D Biol Crystallogr. 2006 Jun;62(Pt 6):671-7. Epub 2006 May 12. [PubMed:16699195 ]