You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08644
Secondary Accession Numbers
  • 14363
Name Eukaryotic translation initiation factor 2-alpha kinase 1
Synonyms
  1. HCR
  2. Heme-controlled repressor
  3. Heme-regulated eukaryotic initiation factor eIF-2-alpha kinase
  4. Heme-regulated inhibitor
  5. Hemin-sensitive initiation factor 2-alpha kinase
Gene Name EIF2AK1
Protein Type Unknown
Biological Properties
General Function Involved in protein serine/threonine kinase activity
Specific Function Mediates down-regulation of protein synthesis in response to various stress conditions by the phosphorylation of EIF2S1 at 'Ser-48' and 'Ser-51'. Protein synthesis is inhibited at the level of initiation
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
response to stimulus
response to stress
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:7
Locus 7p22
SNPs EIF2AK1
Gene Sequence
>1893 bp
ATGCAGGGGGGCAACTCCGGGGTCCGCAAGCGCGAAGAGGAGGGCGACGGGGCTGGGGCT
GTGGCTGCGCCGCCGGCCATCGACTTTCCCGCCGAGGGCCCGGACCCCGAATATGACGAA
TCTGATGTTCCAGCAGAAATCCAGGTGTTAAAAGAACCCCTACAACAGCCAACCTTCCCT
TTTGCAGTTGCAAACCAACTCTTGCTGGTTTCTTTGCTGGAGCACTTGAGCCACGTGCAT
GAACCAAACCCACTTCGTTCAAGACAGGTGTTTAAGCTACTTTGCCAGACGTTTATCAAA
ATGGGGCTGCTGTCTTCTTTCACTTGTAGTGACGAGTTTAGCTCATTGAGACTACATCAC
AACAGAGCTATTACTCACTTAATGAGGTCTGCTAAAGAGAGAGTTCGTCAGGATCCTTGT
GAGGATATTTCTCGTATCCAGAAAATCAGATCAAGGGAAGTAGCCTTGGAAGCACAAACT
TCACGTTACTTAAATGAATTTGAAGAACTTGCCATCTTAGGAAAAGGTGGATACGGAAGA
GTATACAAGGTCAGGAATAAATTAGATGGTCAGTATTATGCAATAAAAAAAATCCTGATT
AAGGGTGCAACTAAAACAGTTTGCATGAAGGTCCTACGGGAAGTGAAGGTGCTGGCAGGT
CTTCAGCACCCCAATATTGTTGGCTATCACACCGCGTGGATAGAACATGTTCATGTGATT
CAGCCACGAGCAGACAGAGCTGCCATTGAGTTGCCATCTCTGGAAGTGCTCTCCGACCAG
GAAGAGGACAGAGAGCAATGTGGTGTTAAAAATGATGAAAGTAGCAGCTCATCCATTATC
TTTGCTGAGCCCACCCCAGAAAAAGAAAAACGCTTTGGAGAATCTGACACTGAAAATCAG
AATAACAAGTCGGTGAAGTACACCACCAATTTAGTCATAAGAGAATCTGGTGAACTTGAG
TCGACCCTGGAGCTCCAGGAAAATGGCTTGGCTGGTTTGTCTGCCAGTTCAATTGTGGAA
CAGCAGCTGCCACTCAGGCGTAATTCCCACCTAGAGGAGAGTTTCACATCCACCGAAGAA
TCTTCCGAAGAAAATGTCAACTTTTTGGGTCAGACAGAGGCACAGTACCACCTGATGCTG
CACATCCAGATGCAGCTGTGTGAGCTCTCGCTGTGGGATTGGATAGTCGAGAGAAACAAG
CGGGGCCGGGAGTATGTGGACGAGTCTGCCTGTCCTTATGTTATGGCCAATGTTGCAACA
AAAATTTTTCAAGAATTGGTAGAAGGTGTGTTTTACATACATAACATGGGAATTGTGCAC
CGAGATCTGAAGCCAAGAAATATTTTTCTTCATGGCCCTGATCAGCAAGTAAAAATAGGA
GACTTTGGTCTGGCCTGCACAGACATCCTACAGAAGAACACAGACTGGACCAACAGAAAC
GGGAAGAGAACACCAACACATACGTCCAGAGTGGGTACTTGTCTGTACGCTTCACCCGAA
CAGTTGGAAGGATCTGAGTATGATGCCAAGTCAGATATGTACAGCTTGGGTGTGGTCCTG
CTAGAGCTCTTTCAGCCGTTTGGAACAGAAATGGAGCGAGCAGAAGTTCTAACAGGTTTA
AGAACTGGTCAGTTGCCGGAATCCCTCCGTAAAAGGTGTCCAGTGCAAGCCAAGTATATC
CAGCACTTAACGAGAAGGAACTCATCGCAGAGACCATCTGCCATTCAGCTGCTGCAGAGT
GAACTTTTCCAAAATTCTGGAAATGTTAACCTCACCCTACAGATGAAGATAATAGAGCAA
GAAAAAGAAATTGCAGAACTAAAGAAGCAGCTAAACCTCCTTTCTCAAGACAAAGGGGTG
AGGGATGACGGAAAGGATGGGGGCGTGGGATGA
Protein Properties
Number of Residues 630
Molecular Weight 71105.9
Theoretical pI 5.86
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Eukaryotic translation initiation factor 2-alpha kinase 1
MQGGNSGVRKREEEGDGAGAVAAPPAIDFPAEGPDPEYDESDVPAEIQVLKEPLQQPTFP
FAVANQLLLVSLLEHLSHVHEPNPLRSRQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHH
NRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALEAQTSRYLNEFEELAILGKGGYGR
VYKVRNKLDGQYYAIKKILIKGATKTVCMKVLREVKVLAGLQHPNIVGYHTAWIEHVHVI
QPRADRAAIELPSLEVLSDQEEDREQCGVKNDESSSSSIIFAEPTPEKEKRFGESDTENQ
NNKSVKYTTNLVIRESGELESTLELQENGLAGLSASSIVEQQLPLRRNSHLEESFTSTEE
SSEENVNFLGQTEAQYHLMLHIQMQLCELSLWDWIVERNKRGREYVDESACPYVMANVAT
KIFQELVEGVFYIHNMGIVHRDLKPRNIFLHGPDQQVKIGDFGLACTDILQKNTDWTNRN
GKRTPTHTSRVGTCLYASPEQLEGSEYDAKSDMYSLGVVLLELFQPFGTEMERAEVLTGL
RTGQLPESLRKRCPVQAKYIQHLTRRNSSQRPSAIQLLQSELFQNSGNVNLTLQMKIIEQ
EKEIAELKKQLNLLSQDKGVRDDGKDGGVG
GenBank ID Protein 11125768
UniProtKB/Swiss-Prot ID Q9BQI3
UniProtKB/Swiss-Prot Entry Name E2AK1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_014413.3
GeneCard ID EIF2AK1
GenAtlas ID EIF2AK1
HGNC ID HGNC:24921
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD, Chen JL: Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning. Proc Natl Acad Sci U S A. 2000 Aug 15;97(17):9543-8. [PubMed:10931946 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  6. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166 ]
  7. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  8. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  9. Nagase T, Kikuno R, Ishikawa KI, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Feb 28;7(1):65-73. [PubMed:10718198 ]
  10. Shao J, Grammatikakis N, Scroggins BT, Uma S, Huang W, Chen JJ, Hartson SD, Matts RL: Hsp90 regulates p50(cdc37) function during the biogenesis of the activeconformation of the heme-regulated eIF2 alpha kinase. J Biol Chem. 2001 Jan 5;276(1):206-14. [PubMed:11036079 ]
  11. Hwang SY, Kim MK, Kim JC: Cloning of hHRI, human heme-regulated eukaryotic initiation factor 2alpha kinase: down-regulated in epithelial ovarian cancers. Mol Cells. 2000 Oct 31;10(5):584-91. [PubMed:11101152 ]
  12. Omasa T, Chen YG, Mantalaris A, Tsai YC, Wu JH: Molecular cloning and sequencing of the human heme-regulated eukaryotic initiation factor 2 alpha (eIF-2 alpha) kinase from bone marrow culture. DNA Seq. 2002 Jun;13(3):133-7. [PubMed:12391722 ]