You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08652
Secondary Accession Numbers
  • 14371
Name Hemoglobin subunit epsilon
Synonyms
  1. Epsilon-globin
  2. Hemoglobin epsilon chain
Gene Name HBE1
Protein Type Unknown
Biological Properties
General Function Involved in iron ion binding
Specific Function The epsilon chain is a beta-type chain of early mammalian embryonic hemoglobin
Pathways Not Available
Reactions Not Available
GO Classification
Component
macromolecular complex
protein complex
hemoglobin complex
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
iron ion binding
heme binding
oxygen binding
Process
establishment of localization
transport
gas transport
oxygen transport
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 11p15.5
SNPs HBE1
Gene Sequence
>441 bp
ATGGTGCATTTTACTGCTGAGGAGAAGGCTGCCGTCACTAGCCTGTGGAGCAAGATGAAT
GTGGAAGAGGCTGGAGGTGAAGCCTTGGGCAGACTCCTCGTTGTTTACCCCTGGACCCAG
AGATTTTTTGACAGCTTTGGAAACCTGTCGTCTCCCTCTGCCATCCTGGGCAACCCCAAG
GTCAAGGCCCATGGCAAGAAGGTGCTGACTTCCTTTGGAGATGCTATTAAAAACATGGAC
AACCTCAAGCCCGCCTTTGCTAAGCTGAGTGAGCTGCACTGTGACAAGCTGCATGTGGAT
CCTGAGAACTTCAAGCTCCTGGGTAACGTGATGGTGATTATTCTGGCTACTCACTTTGGC
AAGGAGTTCACCCCTGAAGTGCAGGCTGCCTGGCAGAAGCTGGTGTCTGCTGTCGCCATT
GCCCTGGCCCATAAGTACCAC
Protein Properties
Number of Residues 147
Molecular Weight 16202.7
Theoretical pI 9.1
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Hemoglobin subunit epsilon
MVHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPK
VKAHGKKVLTSFGDAIKNMDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFG
KEFTPEVQAAWQKLVSAVAIALAHKYH
GenBank ID Protein 49456779
UniProtKB/Swiss-Prot ID P02100
UniProtKB/Swiss-Prot Entry Name HBE_HUMAN
PDB IDs
GenBank Gene ID CR541912
GeneCard ID HBE1
GenAtlas ID HBE1
HGNC ID HGNC:4830
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  3. Sutherland-Smith AJ, Baker HM, Hofmann OM, Brittain T, Baker EN: Crystal structure of a human embryonic haemoglobin: the carbonmonoxy form of gower II (alpha2 epsilon2) haemoglobin at 2.9 A resolution. J Mol Biol. 1998 Jul 17;280(3):475-84. [PubMed:9665850 ]
  4. Baralle FE, Shoulders CC, Proudfoot NJ: The primary structure of the human epsilon-globin gene. Cell. 1980 Oct;21(3):621-6. [PubMed:6254663 ]
  5. Clegg JB: Embryonic hemoglobin: sequence of the epsilon and zeta chains. Tex Rep Biol Med. 1980-1981;40:23-8. [PubMed:6172865 ]