You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08656
Secondary Accession Numbers
  • 14375
Name E3 ubiquitin-protein ligase HERC2
Synonyms
  1. HECT domain and RCC1-like domain-containing protein 2
Gene Name HERC2
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function E3 ubiquitin-protein ligase that regulates ubiquitin- dependent retention of repair proteins on damaged chromosomes. Recruited to sites of DNA damage in response to ionizing radiation (IR) and facilitates the assembly of UBE2N and RNF8 promoting DNA damage-induced formation of 'Lys-63'-linked ubiquitin chains. Acts as a mediator of binding specificity between UBE2N and RNF8. Involved in the maintainance of RNF168 levels. E3 ubiquitin- protein ligase that promotes the ubiquitination and proteosomal degradation of XPA which influences the circadian oscillation of DNA excision repair activity
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
macromolecular complex
protein complex
intracellular
ubiquitin ligase complex
nuclear ubiquitin ligase complex
anaphase-promoting complex
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
small conjugating protein ligase activity
transition metal ion binding
zinc ion binding
ligase activity
iron ion binding
protein binding
heme binding
ligase activity, forming carbon-nitrogen bonds
acid-amino acid ligase activity
ubiquitin-protein ligase activity
Process
metabolic process
macromolecule metabolic process
biological regulation
regulation of biological process
regulation of cell cycle
protein modification by small protein conjugation or removal
protein modification by small protein conjugation
regulation of cellular process
protein ubiquitination
regulation of mitotic cell cycle
regulation of mitosis
regulation of mitotic metaphase/anaphase transition
macromolecule modification
protein modification process
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 15q13
SNPs HERC2
Gene Sequence
>14505 bp
ATGCCCTCTGAATCTTTCTGTTTGGCTGCCCAGGCTCGCCTCGACTCCAAATGGTTGAAA
ACAGATATACAGCTTGCATTCACAAGAGATGGGCTCTGTGGTCTGTGGAATGAAATGGTT
AAAGATGGAGAAATTGTATACACTGGAACAGAATCAACCCAGAACGGAGAGCTCCCTCCT
AGAAAAGATGATAGTGTCGAACCAAGTGGAACAAAGAAAGAAGATCTGAATGACAAAGAG
AAAAAAGATGAAGAAGAAACTCCTGCACCTATATATAGGGCCAAGTCAATTCTGGACAGC
TGGGTATGGGGCAAGCAACCAGATGTGAATGAACTGAAGGAGTGTCTTTCTGTGCTGGTT
AAAGAGCAGCAGGCCCTGGCCGTCCAGTCAGCCACCACCACCCTCTCAGCCCTGCGACTC
AAGCAGAGGCTGGTGATCTTGGAGCGCTATTTCATTGCCTTGAATAGAACCGTTTTTCAG
GAGAATGTCAAAGTTAAGTGGAAAAGCAGCGGTATTTCTCTGCCTCCTGTGGACAAAAAA
AGTTCCCGGCCTGCGGGCAAAGGTGTGGAGGGGCTCGCCAGAGTGGGATCCCGAGCGGCG
CTGTCTTTTGCCTTTGCCTTCCTGCGCAGGGCCTGGCGATCAGGCGAGGATGCGGACCTC
TGCAGTGAGCTGTTGCAGGAGTCCCTGGACGCCCTGCGAGCACTTCCCGAGGCCTCGCTC
TTTGACGAGAGCACCGTGTCCTCTGTGTGGCTGGAGGTGGTGGAGAGAGCGACCAGGTTC
CTCAGGTCCGTCGTGACGGGGGATGTTCACGGAACGCCAGCCACCAAAGGGCCAGGAAGC
ATCCCCCTGCAGGACCAGCACTTGGCCCTGGCCATCCTGCTGGAGCTGGCTGTGCAGAGA
GGCACGCTGAGCCAAATGTTGTCTGCCATCCTGTTGTTGCTTCAGCTGTGGGACAGCGGG
GCACAGGAGACTGACAATGAGCGTTCCGCCCAGGGCACCAGCGCCCCACTTTTGCCCTTG
CTGCAAAGGTTCCAGAGCATCATTTGCAGGAAGGATGCACCCCACTCCGAGGGCGACATG
CACCTTTTGTCTGGCCCTCTGAGCCCCAATGAGAGTTTCCTGAGGTACCTCACCCTTCCA
CAAGACAACGAGCTTGCCATTGATCTGCGACAAACGGCGGTTGTTGTCATGGCCCATTTA
GACCGTCTGGCTACGCCCTGTATGCCTCCGCTGTGTAGCTCTCCGACATCTCATAAGGGA
TCATTGCAAGAGGTCATAGGTTGGGGGTTAATAGGATGGAAATACTATGCCAATGTGATT
GGTCCAATCCAGTGCGAAGGCCTGGCCAACCTGGGAGTCACACAGATTGCCTGTGCAGAG
AAGCGTTTCCTGATTCTGTCACGCAATGGCCGCGTGTACACACAGGCCTATAATAGTGAC
ACGCTGGCCCCACAGCTGGTCCAAGGCCTTGCCTCCAGAAACATTGTAAAAATTGCTGCC
CATTCTGATGGTCACCACTACCTAGCCTTGGCTGCTACTGGAGAGGTGTACTCCTGGGGC
TGTGGGGACGGCGGACGGCTGGGCCATGGGGACACTGTGCCTTTGGAGGAGCCTAAGGTG
ATCTCCGCCTTCTCTGGAAAGCAGGCCGGGAAGCACGTGGTGCACATCGCTTGCGGGAGC
ACTTACAGTGCGGCCATCACTGCCGAGGGGGAGCTGTACACCTGGGGCCGCGGGAACTAC
GGCCGGCTGGGCCATGGCTCCAGTGAGGACGAGGCCATTCCGATGCTGGTAGCCGGGCTT
AAAGGACTGAAGGTCATCGATGTGGCGTGTGGGAGTGGGGATGCTCAAACCCTGGCTGTC
ACTGAGAACGGGCAAGTGTGGTCTTGGGGAGATGGTGACTATGGGAAATTGGGCAGAGGT
GGTAGTGATGGCTGCAAAACCCCAAAGCTGATTGAAAAGCTTCAAGACTTGGATGTGGTC
AAAGTCCGCTGTGGAAGTCAGTTTTCCATTGCTTTGACGAAAGATGGCCAAGTTTATTCA
TGGGGAAAAGGTGACAACCAGAGACTTGGACATGGAACAGAGGAACATGTTCGTTATCCA
AAACTCTTAGAAGGCTTGCAAGGGAAGAAGGTGATTGATGTGGCTGCAGGCTCCACCCAC
TGCCTGGCTCTGACTGAGGACAGCGAGGTCCACAGCTGGGGGAGCAACGACCAGTGCCAG
CACTTTGACACCTTGCGCGTGACCAAGCCAGAACCTGCAGCATTGCCAGGACTGGACACC
AAACACATAGTGGGAATTGCCTGTGGGCCTGCCCAGAGCTTTGCTTGGTCATCATGTTCT
GAGTGGTCCATTGGCCTCCGTGTCCCTTTTGTGGTGGACATCTGCTCAATGACTTTTGAG
CAGCTGGATCTCCTGCTTCGGCAGGTGAGTGAGGGGATGGATGGTTCCGCGGACTGGCCC
CCGCCCCAGGAGAAAGAGTGTGTGGCCGTGGCAACGCTGAATCTTCTACGACTTCAGTTG
CATGCTGCCATTAGTCACCAGGTTGACCCGGAATTCCTTGGTTTAGGTCTGGGCAGCATC
CTCCTGAACAGCCTGAAGCAGACGGTGGTGACCCTGGCCAGCAGTGCGGGCGTGCTGAGC
ACCGTGCAGTCGGCCGCCCAGGCCGTGCTGCAGAGTGGCTGGTCCGTGCTGCTGCCCACC
GCGGAGGAGCGGGCCCGGGCACTCTCTGCTCTCCTGCCCTGCGCAGTTTCAGGCAATGAA
GTGAACATAAGTCCAGGTCGTCGATTCATGATTGATCTTCTGGTGGGCAGCTTGATGGCT
GATGGAGGGTTGGAGTCAGCCTTACACGCAGCCATTACTGCAGAGATCCAGGATATTGAA
GCCAAAAAAGAAGCACAGAAGGAAAAAGAAATTGATGAACAGGAAGCGAATGCCTCAACA
TTTCATAGAAGCAGGACTCCACTGGATAAAGACCTTATTAATACGGGGATCTGTGAGTCT
TCTGGCAAACAGTGTTTGCCTCTGGTTCAGCTCATACAACAGCTTCTTAGAAACATTGCT
TCTCAGACTGTAGCCAGATTGAAAGATGTTGCCCGTCGGATTTCATCATGTCTGGACTTT
GAGCAACACAGTCGTGAAAGATCTGCTTCATTGGATTTGTTACTGCGTTTTCAACGTTTG
CTTATTAGTAAACTTTATCCAGGAGAAAGTATTGGTCAGACCTCAGATATTTCTAGTCCA
GAGCTAATGGGTGTTGGTTCCTTGCTGAAGAAGTACACAGCCCTCCTGTGCACGCACATT
GGAGATATACTGCCTGTGGCCGCCAGCATTGCTTCTACCAGCTGGCGGCACTTCGCGGAG
GTGGCTTACATTGTGGAAGGGGACTTTACTGGTGTTCTCCTTCCAGAACTAGTAGTTTCT
ATAGTGCTTCTGCTCAGTAAAAATGCTGGTCTCATGCAAGAGGCTGGAGCTGTACCTCTG
CTGGGTGGCCTGTTGGAACATCTGGATCGGTTCAACCATCTGGCACCAGGAAAGGAACGG
GATGATCATGAAGAGTTAGCCTGGCCTGGCATAATGGAGTCATTTTTTACAGGTCAGAAC
TGTAGAAATAATGAGGAAGTGACACTTATACGCAAAGCTGATTTGGAGAACCATAATAAA
GATGGAGGCTTCTGGACTGTGATTGACGGGAAGGTGTATGATATAAAGGACTTCCAGACA
CAGTCGTTAACAGGAAATAGTATTCTTGCTCAGTTTGCAGGGGAAGACCCAGTGGTAGCT
TTGGAAGCTGCTTTGCAGTTTGAAGACACCCGGGAATCCATGCACGCGTTTTGTGTTGGC
CAGTATTTGGAGCCTGACCAAGAAATCGTCACCATACCAGATCTGGGGAGTCTCTCTTCA
CCTCTGATAGACACAGAGAGGAATCTGGGCCTGCTTCTCGGATTACACGCTTCGTATTTG
GCAATGAGCACACCGCTGTCTCCTGTCGAGATTGAATGTGCCAAATGGCTTCAGTCATCC
ATCTTCTCTGGAGGCCTGCAGACCAGCCAGATCCACTACAGCTACAACGAGGAGAAAGAC
GAGGACCACTGCAGCTCCCCAGGGGGCACACCTGCCAGCAAATCTCGACTCTGCTCCCAC
AGACGGGCCCTGGGGGACCATTCCCAGGCATTTCTGCAAGCCATTGCAGACAACAACATT
CAGGATCACAACGTGAAGGACTTTTTGTGTCAAATAGAAAGGTACTGTAGGCAGTGCCAT
TTGACCACACCGATCATGTTTCCCCCCGAGCATCCCGTGGAAGAGGTCGGTCGCTTGTTG
TTATGTTGCCTCTTAAAACATGAAGATTTAGGTCATGTGGCATTATCTTTAGTTCATGCA
GGTGCACTTGGTATTGAGCAAGTAAAGCACAGAACGTTGCCTAAGTCAGTGGTGGATGTT
TGTAGAGTTGTCTACCAAGCAAAATGTTCGCTCATTAAGACTCATCAAGAACAGGGCCGT
TCTTACAAGGAGGTCTGCGCTCCTGTCATCGAACGTTTGAGATTCCTCTTTAATGAATTG
AGACCTGCTGTTTGTAATGACCTCTCTATAATGTCTAAGTTTAAATTGTTAAGTTCTTTG
CCCCGTTGGAGGAGGATAGCTCAAAAGATAATTCGAGAACGAAGGAAAAAGAGAGTTCCT
AAGAAGCCAGAATCTACGGATGATGAAGAAAAAATTGGAAACGAAGAGAGTGATTTAGAA
GAAGCTTGCATTTTGCCTCATAGTCCAATAAATGTGGACAAGAGACCCATTGCAATTAAA
TCACCCAAGGACAAATGGCAGCCGCTGTTGAGTACTGTTACAGGTGTTCACAAATACAAG
TGGTTGAAGCAGAATGTGCAGGGTCTTTATCCGCAGTCTCCACTCCTCAGTACAATTGCT
GAATTTGCCCTTAAAGAAGAGCCAGTGGATGTGGAAAAAATGAGAAAGTGCCTACTAAAA
CAGTTGGAGAGAGCAGAGGTTCGCCTGGAAGGGATAGATACAATTTTAAAACTGGCGAGC
AAGAATTTCTTACTTCCATCTGTGCAGTATGCGATGTTTTGTGGATGGCAAAGACTTATT
CCTGAGGGAATCGATATAGGGGAACCTCTTACTGATTGTTTAAAGGATGTTGATTTGATC
CCGCCTTTTAATCGGATGCTGCTGGAAGTCACCTTTGGCAAGCTGTACGCTTGGGCTGTA
CAGAACATTCGAAATGTTTTGATGGATGCCAGTGCCAAATTTAAAGAGCTTGGTATCCAG
CCGGTTCCCCTGCAAACCATCACCAATGAGAACCCGTCAGGACCGAGCCTGGGGACCATC
CCGCAAGCCCGCTTCCTCCTGGTGATGCTCAGCATGCTCACCCTGCAGCACGGCGCAAAC
AACCTCGACCTTCTGCTCAATTCCGGCATGCTGGCCCTCACGCAGACGGCACTGCGCCTG
ATTGGCCCCAGTTGTGACAACGTTGAGGAAGATATGAATGCTTCTGCTCAAGGTGCTTCT
GCCACAGTTTTGGAAGAAACAAGGAAGGAAACGGCTCCTGTGCAGCTCCCTGTTTCAGGA
CCAGAACTGGCTGCCATGATGAAGATTGGAACAAGGGTCATGAGAGGTGTGGACTGGAAA
TGGGGCGATCAGGATGGGCCTCCTCCAGGCCTAGGCCGCGTGATTGGTGAGCTGGGAGAG
GACGGATGGATAAGAGTCCAGTGGGACACAGGCAGCACCAACTCCTACAGGATGGGGAAA
GAAGGAAAATACGACCTCAAGCTGGCAGAGCTGCCGGCTGCTGCACAGCCCTCAGCAGAG
GATTCGGACACAGAGGATGACTCTGAAGCCGAACAAACTGAAAGGAACATTCACCCCACT
GCAATGATGTTTACCAGCACTATTAACTTACTGCAGACTCTTTGTCTGTCTGCTGGAGTT
CATGCTGAGATCATGCAGAGCGAAGCCACCAAGACTTTATGCGGACTGCTGCGAATGTTA
GTGGAAAGCGGAACGACGGACAAGACATCTTCTCCAAACAGGCTGGTGTACAGGGAGCAA
CACCGGAGCTGGTGCACGCTGGGGTTTGTGCGGAGCATCGCTCTCACGCCGCAGGTATGC
GGCGCCCTCAGCTCCCCGCAGTGGATCACGCTGCTCATGAAGGTCGTGGAAGGGCACGCA
CCCTTCACTGCCACCTCGCTGCAGAGGCAGATCTTAGCTGTGCATTTGTTGCAAGCAGTC
CTTCCATCATGGGACAAGACCGAAAGGGCGAGGGACATGAAATGCCTCGTGGAGAAGCTG
TTTGACTTCTTGGGAAGCTTGCTCACTACCTGCTCCTCTGACGTGCCATTACTCAGAGAG
TCCACGCTGAGGCGGCGCAGGGTGCGCCCGCAGGCCTCGCTGACTGCCACCCACAGCAGC
ACACTGGCGGAGGAGGTGGTGGCACTGCTGCGCACGCTGCACTCCCTGACTCAGTGGAAT
GGGCTCATCAACAAGTACATCAACTCCCAGCTCCGCTCCATCACCCACAGCTTTGTGGGA
AGGCCTTCCGAAGGGGCCCAGTTAGAGGACTACTTCCCCGACTCCGAGAACCCTGAAGTG
GGGGGCCTCATGGCAGTCCTGGCTGTGATTGGAGGCATCGATGGTCGCCTGCGCCTGGGC
GGTCAAGTTATGCACGATGAGTTTGGAGAAGGCACTGTGACTCGCATCACCCCAAAGGGC
AAAATCACCGTGCAGTTCTCTGACATGCGGACGTGTCGCGTTTGCCCATTGAATCAGCTG
AAACCACTCCCTGCCGTGGCCTTTAATGTGAACAACCTGCCCTTCACAGAGCCCATGCTG
TCTGTCTGGGCTCAGTTGGTGAACCTCGCTGGAAGCAAGTTAGAAAAGCACAAAATAAAG
AAATCGACTAAACAGGCCTTTGCAGGACAAGTGGACCTGGACCTGCTGCGGTGCCAGCAG
TTGAAGCTATACATCCTGAAAGCAGGTCGGGCGCTGCTCTCCCACCAGGATAAACTGCGG
CAGATCCTGTCTCAGCCAGCTGTTCAGGAGACTGGAACTGTTCACACAGATGATGGAGCA
GTGGTATCACCTGACCTTGGGGACATGTCTCCTGAAGGGCCGCAGCCCCCCATGATCCTC
TTGCAGCAGCTGCTGGCCTCGGCCACCCAGCCGTCTCCTGTGAAGGCCATATTTGATAAA
CAGGAACTTGAGGCTGCTGCACTGGCCGTTTGCCAGTGCTTGGCTGTGGAGTCCACTCAC
CCTTCGAGCCCAGGATTTGAAGACTGCAGCTCCAGTGAGGCCACCACGCCTGTCGCCGTG
CAGCACATCCGCCCTGCCAGAGTGAAGAGGCGCAAGCAGTCGCCCGTTCCCGCTCTGCCG
ATCGTGGTGCAGCTCATGGAGATGGGATTTTCCAGAAGGAACATCGAGTTTGCCCTGAAG
TCTCTCACTGGTGCTTCCGGGAATGCATCCAGCTTGCCTGGTGTGGAAGCCTTGGTCGGG
TGGCTGCTGGACCACTCCGACATACAGGTCACGGAGCTCTCAGATGCAGACACGGTGTCC
GACGAGTATTCTGACGAGGAGGTGGTGGAGGACGTGGATGATGCCGCCTACTCCATGTCT
ACTGGTGCTGTTGTGACGGAGAGCCAGACGTACAAAAAACGAGCTGATTTCTTGAGTAAT
GATGATTATGCTGTATATGTGAGAGAGAATATTCAGGTGGGAATGATGGTTAGATGCTGC
CGAGCGTATGAAGAAGTGTGCGAAGGTGATGTTGGCAAAGTCATCAAGCTGGACAGAGAT
GGATTGCATGATCTCAATGTGCAGTGTGACTGGCAGCAGAAAGGGGGCACCTACTGGGTT
AGGTACATTCATGTGGAACTTATAGGCTATCCTCCACCAAGTTCTTCTTCTCACATCAAG
ATTGGTGATAAAGTGCGGGTCAAAGCCTCTGTCACCACACCAAAATACAAATGGGGATCT
GTGACTCATCAGAGTGTGGGGGTTGTGAAAGCTTTCAGTGCCAATGGAAAAGATATCATT
GTCGACTTTCCCCAGCAGTCTCACTGGACTGGGTTGCTATCAGAAATGGAGTTGGTACCC
AGTATTCATCCTGGGGTTACGTGTGATGGATGTCAGATGTTTCCTATCAATGGATCCAGA
TTCAAATGCAGAAACTGTGATGACTTTGATTTTTGTGAAACGTGTTTCAAGACCAAAAAA
CACAATACCAGGCATACATTTGGCAGAATAAATGAACCAGGTCAGTCTGCGGTATTTTGT
GGCCGTTCTGGAAAACAGCTGAAGCGTTGCCACAGCAGCCAGCCAGGCATGCTGCTGGAC
AGCTGGTCCCGCATGGTGAAGAGCCTGAATGTGTCGTCCTCCGTGAACCAGGCATCCCGT
CTCATTGACGGCAGCGAGCCCTGCTGGCAGTCATCGGGGTCGCAAGGAAAGCACTGGATT
CGTTTGGAGATTTTCCCAGATGTTCTTGTTCATAGATTAAAAATGATCGTAGATCCTGCT
GACAGTAGCTACATGCCGTCCCTGGTTGTAGTGTCAGGTGGAAATTCCCTGAATAACCTT
ATTGAACTAAAGACAATCAATATTAACCCTTCTGACACCACAGTGCCCCTTCTGAATGAC
TGCACAGAGTATCACAGGTATATTGAAATTGCTATAAAGCAGTGCAGGAGCTCAGGAATC
GATTGTAAAATCCATGGTCTCATCCTGCTGGGACGGATCCGTGCAGAAGAGGAAGATTTG
GCTGCAGTTCCTTTCTTAGCTTCGGATAATGAAGAGGAGGAGGATGAGAAAGGCAACAGC
GGAAGCCTCATTAGAAAGAAGGCTGCTGGGCTGGAATCAGCAGCTACGATAAGAACCAAG
GTGTTTGTGTGGGGCCTGAATGACAAGGACCAGCTGGGCGGGCTGAAAGGCTCCAAGATA
AAGGTTCCTTCGTTCTCTGAGACACTGTCAGCTTTGAATGTGGTACAGGTGGCTGGTGGA
TCTAAAAGTTTGTTTGCAGTGACTGTGGAAGGGAAGGTGTATGCCTGTGGAGAAGCCACG
AATGGCCGGCTGGGGCTGGGCATTTCCAGCGGGACGGTGCCCATCCCACGGCAGATCACA
GCTCTCAGCAGCTACGTGGTCAAGAAGGTGGCTGTTCACTCAGGTGGCCGGCACGCGACG
GCTTTAACTGTCGATGGAAAAGTGTTTTCGTGGGGCGAAGGTGACGATGGAAAACTTGGA
CACTTCAGCAGAATGAACTGTGACAAACCAAGGCTGATCGAGGCCCTGAAAACCAAGCGT
ATCCGGGATATCGCCTGTGGGAGCTCGCACAGCGCAGCCCTCACATCCAGCGGAGAACTG
TACACCTGGGGCCTCGGCGAGTACGGCCGGCTGGGACATGGGGATAATACGACACAGCTA
AAGCCCAAAATGGTGAAAGTCCTTCTCGGTCACAGAGTAATCCAGGTTGCATGTGGGAGT
AGAGACGCGCAGACCCTGGCTCTGACCGATGAAGGTTTGGTATTTTCCTGGGGTGATGGT
GACTTTGGAAAACTGGGCCGGGGCGGAAGTGAAGGCTGTAACATTCCCCAGAACATTGAG
AGACTAAATGGACAGGGGGTGTGCCAGATTGAGTGTGGAGCTCAGTTCTCCCTGGCGCTC
ACCAAGTCTGGAGTGGTGTGGACATGGGGAAAGGGGGATTACTTCAGATTGGGCCACGGC
TCTGACGTGCACGTGCGGAAACCACAGGTGGTGGAAGGGCTGAGAGGGAAGAAGATCGTG
CATGTGGCTGTCGGGGCCCTGCACTGCCTGGCGGTCACGGACTCGGGGCAGGTGTATGCT
TGGGGTGACAACGACCACGGCCAGCAGGGCAATGGCACGACCACGGTTAACAGGAAGCCC
ACACTCGTGCAAGGCTTAGAAGGCCAGAAGATCACACGCGTGGCTTGTGGGTCGTCCCAC
AGTGTGGCGTGGACAACTGTGGATGTGGCCACGCCCTCTGTCCACGAGCCCGTCCTCTTC
CAGACTGCAAGAGACCCTTTAGGTGCTTCCTATTTAGGCGTGCCTTCAGATGCTGATTCT
TCTGCTGCCAGTAATAAAATAAGTGGTGCAAGTAATTCTAAGCCAAATCGCCCTTCTCTT
GCCAAGATTCTCTTGTCATTGGATGGAAATCTGGCCAAACAGCAGGCCTTATCACATATT
CTTACAGCATTGCAAATCATGTATGCCAGAGATGCTGTTGTCGGGGCCCTGATGCCGGCC
GCCATGATCGCCCCGGTGGAGTGCCCCTCGTTCTCCTCGGCGGCCCCTTCCGACGCATCT
GCGATGGCTAGTCCCATGAATGGAGAAGAATGCATGCTGGCTGTTGATATCGAAGACAGA
CTGAGTCCAAATCCATGGCAAGAAAAGAGAGAGATTGTTTCCTCTGAGGACGCAGTGACC
CCCTCTGCAGTGACTCCGTCGGCCCCCTCAGCCTCCGCTCGGCCTTTTATCCCAGTGACG
GATGACCTGGGAGCCGCAAGCATCATTGCAGAAACCATGACCAAAACCAAAGAGGATGTT
GAAAGCCAAAATAAAGCAGCAGGTCCGGAGCCTCAGGCCTTGGATGAGTTCACCAGTCTG
CTGATTGCGGATGACACTCGTGTGGTGGTAGACCTGCTCAAGCTGTCAGTGTGCAGCCGG
GCCGGGGACAGGGGCAGGGATGTGCTCTCCGCGGTGCTTTCCGGCATGGGGACCGCCTAC
CCACAGGTGGCAGATATGCTGTTGGAGCTCTGTGTCACCGAGTTGGAGGATGTGGCCACA
GACTCGCAGAGCGGCCGCCTCTCTTCTCAGCCTGTGGTGGTGGAGAGTAGCCACCCTTAC
ACCGACGACACCTCCACCAGTGGCACAGTGAAGATACCAGGTGCAGAAGGACTCAGGGTA
GAATTTGACCGGCAGTGCTCCACAGAGAGGCGCCACGACCCTCTCACAGTCATGGACGGC
GTCAACAGGATCGTCTCCGTGCGGTCAGGCCGAGAGTGGTCCGACTGGTCCAGCGAGCTG
CGCATCCCAGGGGATGAGTTAAAGTGGAAGTTCATCAGCGATGGGTCTGTGAATGGCTGG
GGCTGGCGCTTCACCGTCTATCCCATCATGCCAGCTGCTGGCCCTAAAGAACTCCTCTCT
GACCGCTGCGTCCTCTCCTGTCCATCCATGGACTTGGTGACGTGTCTGTTAGACTTCCGA
CTCAACCTTGCCTCTAACAGAAGCATCGTCCCTCGCCTTGCGGCCTCGCTGGCAGCTTGT
GCACAGCTGAGTGCCCTAGCTGCCAGTCACAGAATGTGGGCCCTTCAGAGACTGAGGAAG
CTGCTTACAACTGAATTTGGGCAGTCAATTAACATAAATAGGCTGCTTGGAGAAAATGAT
GGGGAAACAAGAGCTTTGAGTTTTACAGGTAGTGCTCTTGCTGCTTTGGTGAAAGGTCTT
CCAGAAGCTTTGCAAAGGCAGTTTGAATATGAAGATCCTATTGTGAGGGGTGGCAAACAG
CTGCTCCACAGCCCATTCTTTAAGGTACTGGTAGCTCTTGCTTGTGACCTGGAGCTGGAC
ACTCTGCCTTGCTGTGCCGAGACGCACAAGTGGGCCTGGTTCCGGAGGTACTGCATGGCC
TCCCGTGTTGCTGTGGCCCTTGACAAAAGAACACCGTTGCCCCGTCTGTTTCTTGATGAG
GTGGCTAAGAAAATTCGTGAATTAATGGCAGACAGCGAAAACATGGATGTTCTGCATGAG
AGCCATGACATTTTTAAAAGAGAGCAAGACGAACAACTTGTGCAGTGGATGAACAGGCGA
CCAGATGACTGGACTCTCTCTGCTGGTGGCAGTGGAACAATTTATGGATGGGGACATAAT
CACAGGGGCCAGCTCGGGGGCATTGAAGGCGCAAAAGTCAAAGTTCCCACTCCCTGTGAA
GCCCTTGCAACTCTCAGACCCGTGCAGTTAATCGGAGGGGAACAGACCCTCTTTGCTGTG
ACGGCTGATGGGAAGCTGTATGCCACTGGGTATGGTGCAGGTGGCAGACTAGGCATTGGA
GGGACAGAGTCGGTGTCCACCCCAACATTGCTTGAATCCATTCAGCATGTGTTTATTAAG
AAAGTAGCTGTGAACTCTGGAGGAAAGCACTGCCTTGCCCTGTCTTCAGAAGGAGAAGTT
TACTCTTGGGGTGAGGCAGAAGATGGGAAGTTGGGGCATGGCAACAGAAGTCCGTGTGAC
CGCCCTCGTGTCATCGAGTCTCTGAGAGGAATTGAAGTGGTCGATGTTGCTGCTGGCGGA
GCCCACAGCGCCTGTGTCACAGCAGCCGGGGACCTCTACACATGGGGCAAAGGCCGCTAC
GGCCGGCTGGGGCACAGCGACAGTGAGGACCAGCTGAAGCCGAAGCTGGTGGAGGCGCTG
CAGGGCCACCGTGTGGTTGACATCGCCTGTGGCAGTGGAGATGCCCAGACCCTCTGCCTC
ACAGATGACGACACTGTCTGGTCCTGGGGGGACGGGGACTACGGCAAGCTCGGCCGGGGA
GGCAGCGATGGCTGTAAAGTGCCTATGAAGATTGATTCTCTTACTGGTCTTGGAGTAGTT
AAAGTGGAATGCGGATCCCAGTTTTCTGTTGCCCTTACCAAATCTGGAGCTGTTTATACC
TGGGGCAAAGGCGATTATCACAGGTTGGGCCATGGATCAGATGACCATGTTCGAAGGCCT
CGGCAGGTCCAAGGGTTGCAGGGGAAGAAAGTCATCGCCATCGCCACTGGCTCCCTGCAC
TGTGTGTGCTGCACAGAGGATGGTGAGGTTTATACATGGGGCGACAATGATGAGGGACAA
CTGGGAGACGGAACCACCAATGCCATCCAGAGGCCTCGGTTGGTAGCTGCCCTTCAGGGT
AAGAAGGTCAACCGTGTGGCCTGTGGCTCAGCACATACCCTCGCCTGGTCGACCAGCAAG
CCCGCCAGTGCTGGCAAACTCCCTGCACAGGTCCCCATGGAGTACAATCACCTGCAGGAG
ATCCCCATCATTGCGCTGAGGAACCGTCTGCTGCTGCTGCACCACCTCTCCGAGCTCTTC
TGCCCCTGCATCCCCATGTTCGACCTGGAAGGCTCGCTCGACGAAACTGGACTCGGGCCT
TCTGTTGGGTTCGACACTCTCCGAGGAATTCTGATATCCCAGGGAAAGGAGGCGGCTTTC
CGGAAAGTAGTACAAGCAACTATGGTACGCGATCGTCAGCATGGCCCCGTCGTGGAGCTG
AACCGCATCCAGGTCAAACGATCAAGGAGCAAAGGCGGGCTGGCCGGCCCCGACGGCACC
AAGTCTGTCTTTGGGCAGATGTGTGCTAAGATGAGCTCGTTTGGTCCCGACAGCCTCCTC
CTTCCTCACCGTGTCTGGAAAGTCAAGTTTGTGGGTGAATCTGTGGATGACTGTGGGGGC
GGCTACAGCGAGTCCATAGCTGAGATCTGTGAGGAGCTGCAGAACGGACTCACGCCCCTG
CTGATCGTGACACCCAACGGGAGGGATGAGTCTGGGGCCAACCGAGACTGCTACCTGCTC
AGCCCGGCCGCCAGAGCACCCGTGCACAGCAGCATGTTCCGCTTCCTGGGTGTGTTGCTG
GGCATTGCCATCCGAACCGGGAGTCCCCTGAGCCTCAACCTTGCCGAGCCTGTCTGGAAG
CAGCTGGCTGGGATGAGCCTCACCATCGCGGACCTCAGTGAGGTTGATAAGGATTTTATT
CCTGGACTCATGTACATCCGAGACAATGAAGCCACCTCAGAGGAGTTTGAAGCCATGAGC
CTGCCCTTCACAGTGCCAAGTGCCAGTGGCCAGGACATTCAGTTGAGCTCCAAGCACACA
CACATCACCCTGGACAACCGCGCGGAGTACGTGCGGCTGGCGATAAACTATAGACTCCAT
GAATTTGATGAGCAGGTGGCTGCTGTTCGGGAAGGAATGGCCCGCGTTGTGCCTGTTCCC
CTCCTCTCTCTGTTCACCGGCTACGAACTGGAGACGATGGTGTGTGGCAGCCCTGACATC
CCGCTGCACCTTCTCAAGTCGGTGGCCACCTATAAAGGCATCGAGCCTTCCGCATCGCTG
ATCCAGTGGTTCTGGGAGGTGATGGAGTCCTTCTCCAACACAGAGCGCTCTCTTTTCCTT
CGCTTCGTCTGGGGCCGGACGAGGCTGCCCAGGACCATCGCCGACTTCCGGGGCCGAGAC
TTCGTCATCCAGGTGTTGGATAAATACAACCCTCCAGACCACTTCCTCCCTGAGTCCTAC
ACCTGTTTCTTCTTGCTGAAGCTGCCCAGGTATTCCTGCAAGCAGGTGCTGGAGGAGAAG
CTCAAGTACGCCATCCACTTCTGCAAGTCCATAGACACAGATGACTACGCTCGCATCGCA
CTTACAGGAGAGCCAGCCGCCGACGACAGCAGCGACGATTCAGATAACGAGGATGTCGAC
TCCTTTGCTTCGGACTCTACACAAGATTATTTAACAGGACACTAA
Protein Properties
Number of Residues 4834
Molecular Weight 527223.0
Theoretical pI 6.22
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>E3 ubiquitin-protein ligase HERC2
MPSESFCLAAQARLDSKWLKTDIQLAFTRDGLCGLWNEMVKDGEIVYTGTESTQNGELPP
RKDDSVEPSGTKKEDLNDKEKKDEEETPAPIYRAKSILDSWVWGKQPDVNELKECLSVLV
KEQQALAVQSATTTLSALRLKQRLVILERYFIALNRTVFQENVKVKWKSSGISLPPVDKK
SSRPAGKGVEGLARVGSRAALSFAFAFLRRAWRSGEDADLCSELLQESLDALRALPEASL
FDESTVSSVWLEVVERATRFLRSVVTGDVHGTPATKGPGSIPLQDQHLALAILLELAVQR
GTLSQMLSAILLLLQLWDSGAQETDNERSAQGTSAPLLPLLQRFQSIICRKDAPHSEGDM
HLLSGPLSPNESFLRYLTLPQDNELAIDLRQTAVVVMAHLDRLATPCMPPLCSSPTSHKG
SLQEVIGWGLIGWKYYANVIGPIQCEGLANLGVTQIACAEKRFLILSRNGRVYTQAYNSD
TLAPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPKV
ISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDEAIPMLVAGL
KGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDVV
KVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDVAAGSTH
CLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPAALPGLDTKHIVGIACGPAQSFAWSSCS
EWSIGLRVPFVVDICSMTFEQLDLLLRQVSEGMDGSADWPPPQEKECVAVATLNLLRLQL
HAAISHQVDPEFLGLGLGSILLNSLKQTVVTLASSAGVLSTVQSAAQAVLQSGWSVLLPT
AEERARALSALLPCAVSGNEVNISPGRRFMIDLLVGSLMADGGLESALHAAITAEIQDIE
AKKEAQKEKEIDEQEANASTFHRSRTPLDKDLINTGICESSGKQCLPLVQLIQQLLRNIA
SQTVARLKDVARRISSCLDFEQHSRERSASLDLLLRFQRLLISKLYPGESIGQTSDISSP
ELMGVGSLLKKYTALLCTHIGDILPVAASIASTSWRHFAEVAYIVEGDFTGVLLPELVVS
IVLLLSKNAGLMQEAGAVPLLGGLLEHLDRFNHLAPGKERDDHEELAWPGIMESFFTGQN
CRNNEEVTLIRKADLENHNKDGGFWTVIDGKVYDIKDFQTQSLTGNSILAQFAGEDPVVA
LEAALQFEDTRESMHAFCVGQYLEPDQEIVTIPDLGSLSSPLIDTERNLGLLLGLHASYL
AMSTPLSPVEIECAKWLQSSIFSGGLQTSQIHYSYNEEKDEDHCSSPGGTPASKSRLCSH
RRALGDHSQAFLQAIADNNIQDHNVKDFLCQIERYCRQCHLTTPIMFPPEHPVEEVGRLL
LCCLLKHEDLGHVALSLVHAGALGIEQVKHRTLPKSVVDVCRVVYQAKCSLIKTHQEQGR
SYKEVCAPVIERLRFLFNELRPAVCNDLSIMSKFKLLSSLPRWRRIAQKIIRERRKKRVP
KKPESTDDEEKIGNEESDLEEACILPHSPINVDKRPIAIKSPKDKWQPLLSTVTGVHKYK
WLKQNVQGLYPQSPLLSTIAEFALKEEPVDVEKMRKCLLKQLERAEVRLEGIDTILKLAS
KNFLLPSVQYAMFCGWQRLIPEGIDIGEPLTDCLKDVDLIPPFNRMLLEVTFGKLYAWAV
QNIRNVLMDASAKFKELGIQPVPLQTITNENPSGPSLGTIPQARFLLVMLSMLTLQHGAN
NLDLLLNSGMLALTQTALRLIGPSCDNVEEDMNASAQGASATVLEETRKETAPVQLPVSG
PELAAMMKIGTRVMRGVDWKWGDQDGPPPGLGRVIGELGEDGWIRVQWDTGSTNSYRMGK
EGKYDLKLAELPAAAQPSAEDSDTEDDSEAEQTERNIHPTAMMFTSTINLLQTLCLSAGV
HAEIMQSEATKTLCGLLRMLVESGTTDKTSSPNRLVYREQHRSWCTLGFVRSIALTPQVC
GALSSPQWITLLMKVVEGHAPFTATSLQRQILAVHLLQAVLPSWDKTERARDMKCLVEKL
FDFLGSLLTTCSSDVPLLRESTLRRRRVRPQASLTATHSSTLAEEVVALLRTLHSLTQWN
GLINKYINSQLRSITHSFVGRPSEGAQLEDYFPDSENPEVGGLMAVLAVIGGIDGRLRLG
GQVMHDEFGEGTVTRITPKGKITVQFSDMRTCRVCPLNQLKPLPAVAFNVNNLPFTEPML
SVWAQLVNLAGSKLEKHKIKKSTKQAFAGQVDLDLLRCQQLKLYILKAGRALLSHQDKLR
QILSQPAVQETGTVHTDDGAVVSPDLGDMSPEGPQPPMILLQQLLASATQPSPVKAIFDK
QELEAAALAVCQCLAVESTHPSSPGFEDCSSSEATTPVAVQHIRPARVKRRKQSPVPALP
IVVQLMEMGFSRRNIEFALKSLTGASGNASSLPGVEALVGWLLDHSDIQVTELSDADTVS
DEYSDEEVVEDVDDAAYSMSTGAVVTESQTYKKRADFLSNDDYAVYVRENIQVGMMVRCC
RAYEEVCEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHVELIGYPPPSSSSHIK
IGDKVRVKASVTTPKYKWGSVTHQSVGVVKAFSANGKDIIVDFPQQSHWTGLLSEMELVP
SIHPGVTCDGCQMFPINGSRFKCRNCDDFDFCETCFKTKKHNTRHTFGRINEPGQSAVFC
GRSGKQLKRCHSSQPGMLLDSWSRMVKSLNVSSSVNQASRLIDGSEPCWQSSGSQGKHWI
RLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININPSDTTVPLLND
CTEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDLAAVPFLASDNEEEEDEKGNS
GSLIRKKAAGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQVAGG
SKSLFAVTVEGKVYACGEATNGRLGLGISSGTVPIPRQITALSSYVVKKVAVHSGGRHAT
ALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAALTSSGEL
YTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFSWGDG
DFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHG
SDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDSGQVYAWGDNDHGQQGNGTTTVNRKP
TLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTARDPLGASYLGVPSDADS
SAASNKISGASNSKPNRPSLAKILLSLDGNLAKQQALSHILTALQIMYARDAVVGALMPA
AMIAPVECPSFSSAAPSDASAMASPMNGEECMLAVDIEDRLSPNPWQEKREIVSSEDAVT
PSAVTPSAPSASARPFIPVTDDLGAASIIAETMTKTKEDVESQNKAAGPEPQALDEFTSL
LIADDTRVVVDLLKLSVCSRAGDRGRDVLSAVLSGMGTAYPQVADMLLELCVTELEDVAT
DSQSGRLSSQPVVVESSHPYTDDTSTSGTVKIPGAEGLRVEFDRQCSTERRHDPLTVMDG
VNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAAGPKELLS
DRCVLSCPSMDLVTCLLDFRLNLASNRSIVPRLAASLAACAQLSALAASHRMWALQRLRK
LLTTEFGQSININRLLGENDGETRALSFTGSALAALVKGLPEALQRQFEYEDPIVRGGKQ
LLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTPLPRLFLDE
VAKKIRELMADSENMDVLHESHDIFKREQDEQLVQWMNRRPDDWTLSAGGSGTIYGWGHN
HRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGGRLGIG
GTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRSPCD
RPRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPKLVEAL
QGHRVVDIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVV
KVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATGSLH
CVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHTLAWSTSK
PASAGKLPAQVPMEYNHLQEIPIIALRNRLLLLHHLSELFCPCIPMFDLEGSLDETGLGP
SVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGGLAGPDGT
KSVFGQMCAKMSSFGPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEELQNGLTPL
LIVTPNGRDESGANRDCYLLSPAARAPVHSSMFRFLGVLLGIAIRTGSPLSLNLAEPVWK
QLAGMSLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQLSSKHT
HITLDNRAEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETMVCGSPDI
PLHLLKSVATYKGIEPSASLIQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIADFRGRD
FVIQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDTDDYARIA
LTGEPAADDSSDDSDNEDVDSFASDSTQDYLTGH
GenBank ID Protein 126032348
UniProtKB/Swiss-Prot ID O95714
UniProtKB/Swiss-Prot Entry Name HERC2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004667.4
GeneCard ID HERC2
GenAtlas ID HERC2
HGNC ID HGNC:4868
References
General References
  1. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [PubMed:16572171 ]
  7. Ji Y, Walkowicz MJ, Buiting K, Johnson DK, Tarvin RE, Rinchik EM, Horsthemke B, Stubbs L, Nicholls RD: The ancestral gene for transcribed, low-copy repeats in the Prader-Willi/Angelman region encodes a large protein implicated in protein trafficking, which is deficient in mice with neuromuscular and spermiogenic abnormalities. Hum Mol Genet. 1999 Mar;8(3):533-42. [PubMed:9949213 ]
  8. Ji Y, Rebert NA, Joslin JM, Higgins MJ, Schultz RA, Nicholls RD: Structure of the highly conserved HERC2 gene and of multiple partially duplicated paralogs in human. Genome Res. 2000 Mar;10(3):319-29. [PubMed:10720573 ]
  9. Kayser M, Liu F, Janssens AC, Rivadeneira F, Lao O, van Duijn K, Vermeulen M, Arp P, Jhamai MM, van Ijcken WF, den Dunnen JT, Heath S, Zelenika D, Despriet DD, Klaver CC, Vingerling JR, de Jong PT, Hofman A, Aulchenko YS, Uitterlinden AG, Oostra BA, van Duijn CM: Three genome-wide association studies and a linkage analysis identify HERC2 as a human iris color gene. Am J Hum Genet. 2008 Feb;82(2):411-23. doi: 10.1016/j.ajhg.2007.10.003. Epub 2008 Jan 25. [PubMed:18252221 ]
  10. Sturm RA, Duffy DL, Zhao ZZ, Leite FP, Stark MS, Hayward NK, Martin NG, Montgomery GW: A single SNP in an evolutionary conserved region within intron 86 of the HERC2 gene determines human blue-brown eye color. Am J Hum Genet. 2008 Feb;82(2):424-31. doi: 10.1016/j.ajhg.2007.11.005. Epub 2008 Jan 24. [PubMed:18252222 ]
  11. Eiberg H, Troelsen J, Nielsen M, Mikkelsen A, Mengel-From J, Kjaer KW, Hansen L: Blue eye color in humans may be caused by a perfectly associated founder mutation in a regulatory element located within the HERC2 gene inhibiting OCA2 expression. Hum Genet. 2008 Mar;123(2):177-87. doi: 10.1007/s00439-007-0460-x. Epub 2008 Jan 3. [PubMed:18172690 ]
  12. Mengel-From J, Borsting C, Sanchez JJ, Eiberg H, Morling N: Human eye colour and HERC2, OCA2 and MATP. Forensic Sci Int Genet. 2010 Oct;4(5):323-8. doi: 10.1016/j.fsigen.2009.12.004. Epub 2010 Jan 12. [PubMed:20457063 ]
  13. Bekker-Jensen S, Rendtlew Danielsen J, Fugger K, Gromova I, Nerstedt A, Lukas C, Bartek J, Lukas J, Mailand N: HERC2 coordinates ubiquitin-dependent assembly of DNA repair factors on damaged chromosomes. Nat Cell Biol. 2010 Jan;12(1):80-6; sup pp 1-12. doi: 10.1038/ncb2008. Epub 2009 Dec 20. [PubMed:20023648 ]
  14. Kang TH, Lindsey-Boltz LA, Reardon JT, Sancar A: Circadian control of XPA and excision repair of cisplatin-DNA damage by cryptochrome and HERC2 ubiquitin ligase. Proc Natl Acad Sci U S A. 2010 Mar 16;107(11):4890-5. doi: 10.1073/pnas.0915085107. [PubMed:20304803 ]