You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08663
Secondary Accession Numbers
  • 14382
Name Nuclear respiratory factor 1
Synonyms
  1. Alpha palindromic-binding protein
  2. Alpha-pal
  3. NRF-1
Gene Name NRF1
Protein Type Unknown
Biological Properties
General Function Involved in DNA binding
Specific Function Transcription factor that activates the expression of the EIF2S1 (EIF2-alpha) gene. Links the transcriptional modulation of key metabolic genes to cellular growth and development. Implicated in the control of nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:7
Locus 7q32
SNPs NRF1
Gene Sequence
>1512 bp
ATGGAGGAACACGGAGTGACCCAAACCGAACATATGGCTACCATAGAAGCACATGCAGTG
GCCCAGCAAGTGCAGCAGGTCCATGTGGCTACTTACACCGAGCATAGTATGCTGAGTGCT
GATGAAGACTCGCCTTCTTCGCCCGAGGACACCTCTTACGATGACTCAGATATACTCAAC
TCCACAGCAGCTGATGAGGTGACAGCTCATCTGGCAGCTGCAGGTCCTGTGGGAATGGCC
GCTGCTGCTGCTGTGGCAACAGGAAAGAAACGGAAACGGCCTCATGTATTTGAGTCTAAT
CCATCTATCCGGAAGAGGCAACAAACACGTTTGCTTCGGAAACTTCGAGCCACGTTAGAT
GAATATACTACTCGTGTGGGACAGCAAGCTATTGTCCTCTGTATCTCACCCTCCAAACCT
AACCCTGTCTTTAAAGTGTTTGGTGCAGCACCTTTGGAGAATGTGGTGCGTAAGTACAAG
AGCATGATCCTGGAAGACCTGGAGTCTGCTCTGGCAGAACACGCCCCTGCGCCACAGGAG
GTTAACTCAGAACTGCCGCCTCTCACCATCGACGGAATTCCAGTCTCTGTGGACAAAATG
ACCCAGGCCCAGCTTCGGGCATTTATCCCAGAGATGCTCAAGTACTCTACAGGTCGGGGA
AAACCAGGCTGGGGGAAAGAAAGCTGCAAGCCCATCTGGTGGCCTGAAGATATCCCCTGG
GCAAATGTCCGGAGTGATGTCCGCACAGAAGAGCAAAAGCAGAGGGTTTCATGGACCCAG
GCACTACGGACCATAGTTAAAAACTGTTATAAACAGCATGGGCGGGAAGACCTTTTGTAT
GCCTTTGAAGATCAGCAAACGCAAACACAGGCCACAGCCACACATAGTATAGCTCATCTT
GTACCATCACAGACTGTAGTCCAGACTTTTAGTAACCCTGATGGCACTGTCTCACTTATC
CAGGTTGGTACGGGGGCAACAGTAGCCACATTGGCTGATGCTTCAGAATTGCCAACCACG
GTCACCGTTGCCCAAGTGAATTATTCTGCCGTGGCTGATGGAGAGGTGGAACAAAATTGG
GCCACGTTACAGGGAGGTGAGATGACCATCCAGACGACGCAAGCATCAGAGGCCACCCAG
GCGGTGGCATCGTTGGCAGAGGCCGCAGTGGCAGCTTCTCAGGAGATGCAGCAGGGAGCT
ACAGTCACTATGGCGCTTAACAGCGAAGCTGCCGCCCATGCTGTCGCCACCCTGGCTGAG
GCCACCTTACAAGGTGGGGGACAGATCGTCTTGTCTGGGGAAACCGCAGCAGCCGTCGGA
GCACTTACTGGAGTCCAAGATGCTAATGGCCTGGTCCAGATCCCTGTGAGCATGTACCAG
ACTGTGGTGACCAGCCTCGCCCAGGGCAACGGACCAGTGCAGGTGGCCATGGCCCCTGTG
ACCACCAGGATATCAGACAGCGCAGTCACCATGGACGGCCAAGCTGTGGAGGTGGTGACA
TTGGAACAGTGA
Protein Properties
Number of Residues 503
Molecular Weight 53540.7
Theoretical pI 4.69
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Nuclear respiratory factor 1
MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILN
STAADEVTAHLAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQTRLLRKLRATLD
EYTTRVGQQAIVLCISPSKPNPVFKVFGAAPLENVVRKYKSMILEDLESALAEHAPAPQE
VNSELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPW
ANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQQTQTQATATHSIAHL
VPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSAVADGEVEQNW
ATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSEAAAHAVATLAE
ATLQGGGQIVLSGETAAAVGALTGVQDANGLVQIPVSMYQTVVTSLAQGNGPVQVAMAPV
TTRISDSAVTMDGQAVEVVTLEQ
GenBank ID Protein 347960
UniProtKB/Swiss-Prot ID Q16656
UniProtKB/Swiss-Prot Entry Name NRF1_HUMAN
PDB IDs Not Available
GenBank Gene ID L22454
GeneCard ID NRF1
GenAtlas ID NRF1
HGNC ID HGNC:7996
References
General References
  1. Vercauteren K, Pasko RA, Gleyzer N, Marino VM, Scarpulla RC: PGC-1-related coactivator: immediate early expression and characterization of a CREB/NRF-1 binding domain associated with cytochrome c promoter occupancy and respiratory growth. Mol Cell Biol. 2006 Oct;26(20):7409-19. Epub 2006 Aug 14. [PubMed:16908542 ]
  2. Virbasius CA, Virbasius JV, Scarpulla RC: NRF-1, an activator involved in nuclear-mitochondrial interactions, utilizes a new DNA-binding domain conserved in a family of developmental regulators. Genes Dev. 1993 Dec;7(12A):2431-45. [PubMed:8253388 ]
  3. Efiok BJ, Chiorini JA, Safer B: A key transcription factor for eukaryotic initiation factor-2 alpha is strongly homologous to developmental transcription factors and may link metabolic genes to cellular growth and development. J Biol Chem. 1994 Jul 22;269(29):18921-30. [PubMed:8034649 ]
  4. Gopalakrishnan L, Scarpulla RC: Structure, expression, and chromosomal assignment of the human gene encoding nuclear respiratory factor 1. J Biol Chem. 1995 Jul 28;270(30):18019-25. [PubMed:7629110 ]
  5. Spelbrink JN, Van den Bogert C: The pre-mRNA of nuclear respiratory factor 1, a regulator of mitochondrial biogenesis, is alternatively spliced in human tissues and cell lines. Hum Mol Genet. 1995 Sep;4(9):1591-6. [PubMed:8541844 ]
  6. Gugneja S, Scarpulla RC: Serine phosphorylation within a concise amino-terminal domain in nuclear respiratory factor 1 enhances DNA binding. J Biol Chem. 1997 Jul 25;272(30):18732-9. [PubMed:9228045 ]
  7. Andersson U, Scarpulla RC: Pgc-1-related coactivator, a novel, serum-inducible coactivator of nuclear respiratory factor 1-dependent transcription in mammalian cells. Mol Cell Biol. 2001 Jun;21(11):3738-49. [PubMed:11340167 ]