Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08670
Secondary Accession Numbers
  • 14389
Name Beta,beta-carotene 9',10'-oxygenase
Synonyms
  1. B-diox-II
  2. Beta-carotene dioxygenase 2
Gene Name BCO2
Protein Type Unknown
Biological Properties
General Function Secondary metabolites biosynthesis, transport and catabolism
Specific Function Asymmetrically cleaves beta-carotene at the 9',10' double bond resulting in the formation of beta-apo-10'-carotenal and beta-ionone. Besides beta-carotene, lycopene is also oxidatively cleaved. The apocarotenals formed by this enzyme may be the precursors for the biosynthesis of retinoic acid or exert unknown physiological effects.
Pathways Not Available
Reactions
beta-Carotene + Oxygen → all-trans-10'-apo-beta-carotenal + beta-Ionone details
GO Classification
Biological Process
retinoic acid metabolic process
carotene catabolic process
carotenoid metabolic process
regulation of mitochondrial membrane potential
regulation of reactive oxygen species metabolic process
retinal metabolic process
Cellular Component
mitochondrion
Molecular Function
metal ion binding
oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
Cellular Location Not Available
Gene Properties
Chromosome Location 11
Locus 11q23.1
SNPs BCO2
Gene Sequence
>1740 bp
ATGTTTTTTCGAGTCTTTCTCCATTTTATCAGGAGTCATTCTGCCACTGCAGTGGATTTC
CTTCCTGTGATGGTGCACCGGCTCCCAGTTTTCAAAAGGTACATGGGAAATACTCCTCAG
AAAAAAGCCGTCTTTGGGCAGTGTCGGGGTCTGCCATGTGTTGCACCGCTGCTGACCACA
GTGGAAGAGGCTCCACGGGGCATCTCTGCTCGAGTCTGGGGACATTTTCCTAAGTGGCTC
AATGGCTCTCTACTTCGAATTGGACCTGGGAAATTCGAGTTTGGGAAGGATAAGTACAAT
CATTGGTTTGATGGGATGGCGCTGCTTCACCAGTTCAGAATGGCAAAGGGCACAGTGACA
TACAGGAGCAAGTTTCTACAGAGTGATACATATAAGGCCAACAGTGCTAAAAACCGAATT
GTGATCTCAGAATTTGGCACACTGGCTCTCCCGGATCCATGCAAGAATGTTTTTGAACGT
TTCATGTCCAGGTTTGAGCTGCCTGGTAAAGCTGCAGCCATGACTGACAATACTAATGTC
AACTATGTGCGGTACAAGGGTGATTACTACCTCTGCACTGAGACCAACTTTATGAATAAA
GTGGACATTGAAACTCTGGAAAAAACAGAAAAGGTAGATTGGAGCAAATTTATTGCTGTG
AATGGAGCAACTGCACATCCTCATTATGACCTGGATGGAACAGCATACAATATGGGGAAC
TCCTTTGGGCCATATGGTTTCTCCTATAAGGTTATTCGGGTTCCTCCAGAGAAGGTGGAC
CTTGGGGAGACAATCCATGGAGTCCAGGTGATATGTTCTATTGCTTCTACAGAGAAAGGG
AAACCTTCTTACTACCATAGCTTTGGAATGACAAGGAACTATATAATTTTCATTGAACAA
CCTCTAAAGATGAACCTGTGGAAAATTGCCACTTCTAAAATTCGGGGAAAGGCCTTTTCA
GATGGGATAAGCTGGGAACCCCAGTGTAATACGCGGTTTCATGTGGTGGAAAAACGCACT
GGACAGCTCCTTCCAGGGAGATACTACAGCAAACCTTTTGTTACATTTCATCAAATCAAT
GCCTTTGAGGACCAGGGCTGTGTTATAATTGATTTGTGCTGTCAAGATAATGGAAGAACC
CTAGAAGTTTACCAGTTACAGAATCTCAGGAAGGCTGGGGAAGGGCTTGATCAGGTCCAT
AATTCAGCAGCCAAATCTTTCCCTCGAAGGTTTGTTTTGCCTTTAAATGTCAGTTTGAAT
GCCCCTGAGGGAGACAACCTGAGTCCATTGTCCTATACTTCAGCCAGTGCTGTGAAACAG
GCTGATGGAACGATCTGGTGCTCTCATGAAAATCTACATCAGGAGGACCTAGAAAAGGAA
GGAGGCATTGAATTTCCTCAGATCTACTATGATCGATTCAGTGGCAAAAAGTATCATTTC
TTTTATGGCTGTGGCTTTCGGCATTTAGTGGGGGATTCTCTGATCAAGGTTGATGTGGTG
AATAAGACACTGAAGGTTTGGAGAGAAGATGGCTTTTATCCCTCAGAACCTGTTTTTGTT
CCAGCACCAGGAACCAATGAAGAAGATGGTGGGGTTATTCTTTCTGTGGTGATCACTCCC
AACCAGAATGAAAGCAATTTTATCCTAGTTTTGGATGCCAAGAACTTTGAAGAGCTGGGC
CGAGCAGAGGTACCTGTGCAGATGCCTTATGGGTTCCATGGTACCTTCATACCCATCTGA
Protein Properties
Number of Residues 579
Molecular Weight 61509.65
Theoretical pI 7.964
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Beta,beta-carotene 9',10'-oxygenase
MFFRVFLHFIRSHSATAVDFLPVMVHRLPVFKRYMGNTPQKKAVFGQCRGLPCVAPLLTT
VEEAPRGISARVWGHFPKWLNGSLLRIGPGKFEFGKDKYNHWFDGMALLHQFRMAKGTVT
YRSKFLQSDTYKANSAKNRIVISEFGTLALPDPCKNVFERFMSRFELPGKAAAMTDNTNV
NYVRYKGDYYLCTETNFMNKVDIETLEKTEKVDWSKFIAVNGATAHPHYDLDGTAYNMGN
SFGPYGFSYKVIRVPPEKVDLGETIHGVQVICSIASTEKGKPSYYHSFGMTRNYIIFIEQ
PLKMNLWKIATSKIRGKAFSDGISWEPQCNTRFHVVEKRTGQLLPGRYYSKPFVTFHQIN
AFEDQGCVIIDLCCQDNGRTLEVYQLQNLRKAGEGLDQVHNSAAKSFPRRFVLPLNVSLN
APEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYDRFSGKKYHF
FYGCGFRHLVGDSLIKVDVVNKTLKVWREDGFYPSEPVFVPAPGTNEEDGGVILSVVITP
NQNESNFILVLDAKNFEELGRAEVPVQMPYGFHGTFIPI
GenBank ID Protein 82617624
UniProtKB/Swiss-Prot ID Q9BYV7
UniProtKB/Swiss-Prot Entry Name BCDO2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_031938.4
GeneCard ID BCO2
GenAtlas ID BCO2
HGNC ID HGNC:18503
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  3. Kiefer C, Hessel S, Lampert JM, Vogt K, Lederer MO, Breithaupt DE, von Lintig J: Identification and characterization of a mammalian enzyme catalyzing the asymmetric oxidative cleavage of provitamin A. J Biol Chem. 2001 Apr 27;276(17):14110-6. Epub 2001 Jan 29. [PubMed:11278918 ]
  4. Lindqvist A, He YG, Andersson S: Cell type-specific expression of beta-carotene 9',10'-monooxygenase in human tissues. J Histochem Cytochem. 2005 Nov;53(11):1403-12. Epub 2005 Jun 27. [PubMed:15983114 ]