You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08673
Secondary Accession Numbers
  • 14392
Name Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
Synonyms
  1. DnaJ homolog subfamily C member 20
  2. Hsc20
Gene Name HSCB
Protein Type Unknown
Biological Properties
General Function Involved in heat shock protein binding
Specific Function May act as a co-chaperone in iron-sulfur cluster assembly in mitochondria
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
heat shock protein binding
chaperone binding
Process
metabolic process
macromolecule metabolic process
cellular protein metabolic process
protein folding
protein metabolic process
Cellular Location
  1. Mitochondrion (Potential)
Gene Properties
Chromosome Location Chromosome:2
Locus 22q12.1
SNPs HSCB
Gene Sequence
>708 bp
ATGTGGCGGGGGAGAGCCGGGGCTTTGCTCCGGGTGTGGGGGTTTTGGCCGACAGGGGTT
CCCAGAAGGAGACCGCTAAGCTGCGATGCTGCGTCGCAGGCGGGAAGCAATTATCCCCGC
TGTTGGAACTGCGGCGGCCCATGGGGCCCCGGGCGGGAGGACAGGTTCTTCTGCCCACAG
TGCCGAGCGCTGCAGGCACCTGACCCCACTCGAGACTACTTCAGCCTTATGGACTGCAAC
CGTTCCTTCAGAGTTGATACAGCGAAGCTCCAGCACAGGTACCAGCAACTGCAGCGTCTT
GTCCACCCAGATTTCTTCAGCCAGAGGTCTCAGACTGAAAAGGACTTCTCAGAGAAGCAT
TCGACCCTGGTGAATGATGCCTATAAGACCCTCCTGGCCCCCCTGAGCAGAGGACTGTAC
CTTCTAAAGCTCCATGGAATAGAGATTCCTGAAAGGACAGATTATGAAATGGACAGGCAA
TTCCTCATAGAAATAATGGAAATCAATGAAAAACTCGCAGAAGCTGAAAGTGAAGCTGCC
ATGAAAGAGATTGAATCCATTGTCAAAGCTAAACAGAAAGAATTTACTGACAATGTGAGC
AGTGCTTTTGAACAAGATGACTTTGAAGAAGCCAAGGAAATTTTGACAAAGATGAGATAC
TTTTCAAATATAGAAGAAAAGATCAAGTTAAAGAAGATTCCCCTTTAA
Protein Properties
Number of Residues 235
Molecular Weight 27422.0
Theoretical pI 7.8
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQ
CRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKH
STLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAA
MKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL
GenBank ID Protein 56203009
UniProtKB/Swiss-Prot ID Q8IWL3
UniProtKB/Swiss-Prot Entry Name HSC20_HUMAN
PDB IDs Not Available
GenBank Gene ID AL023494
GeneCard ID HSCB
GenAtlas ID HSCB
HGNC ID HGNC:28913
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  3. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]
  4. Sun G, Gargus JJ, Ta DT, Vickery LE: Identification of a novel candidate gene in the iron-sulfur pathway implicated in ataxia-susceptibility: human gene encoding HscB, a J-type co-chaperone. J Hum Genet. 2003;48(8):415-9. Epub 2003 Aug 19. [PubMed:12938016 ]
  5. Bitto E, Bingman CA, Bittova L, Kondrashov DA, Bannen RM, Fox BG, Markley JL, Phillips GN Jr: Structure of human J-type co-chaperone HscB reveals a tetracysteine metal-binding domain. J Biol Chem. 2008 Oct 31;283(44):30184-92. doi: 10.1074/jbc.M804746200. Epub 2008 Aug 19. [PubMed:18713742 ]