You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08678
Secondary Accession Numbers
  • 14398
Name Epidermis-type lipoxygenase 3
Synonyms
  1. e-LOX-3
Gene Name ALOXE3
Protein Type Unknown
Biological Properties
General Function Involved in metal ion binding
Specific Function Introduces molecular oxygen into polyunsaturated fatty acids. Exact substrate is not known
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
oxidoreductase activity, acting on single donors with incorporation of molecular oxygen
oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
transition metal ion binding
iron ion binding
lipoxygenase activity
oxidoreductase activity
Process
metabolic process
cellular metabolic process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
monocarboxylic acid metabolic process
fatty acid metabolic process
oxidation reduction
unsaturated fatty acid metabolic process
icosanoid metabolic process
leukotriene metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 17p13.1
SNPs ALOXE3
Gene Sequence
>2136 bp
ATGGCAGTGTACCGCCTGTGTGTGACCACTGGTCCCTACCTGAGGGCCGGCACACTGGAC
AACATCTCTGTCACACTGGTGGGCACGTGTGGTGAAAGCCCCAAGCAGCGGCTAGATCGA
ATGGGCAGGGACTTCGCCCCTGGATCGGTACAGAAGTACAAGGTGCGTTGCACAGCGGAG
CTGGGTGAGCTCTTGCTGCTGCGTGTACACAAGGAGCGCTACGCTTTCTTCCGCAAGGAC
TCTTGGTACTGTAGCCGCATCTGTGTCACCGAACCGGATGGTAGTGTATCCCACTTCCCC
TGCTATCAGTGGATTGAAGGCTACTGCACCGTGGAGCTGAGGCCAGGAACAGCAAGAACT
ATTTGTCAGGACTCTCTTCCCCTCCTCCTGGATCACAGGACACGGGAGCTCCGGGCCCGA
CAAGAATGCTACCGCTGGAAGATCTATGCCCCTGGCTTCCCCTGCATGGTAGACGTCAAC
AGCTTTCAGGAGATGGAGTCAGACAAGAAATTTGCCTTGACAAAGACGACAACTTGTGTA
GACCAAGGTGACAGCAGTGGGAATCGGTACCTGCCCGGCTTACCCATGAAAATTGACATC
CCATCCCTGATGTACATGGAGCCCAATGTTCGATACTCAGCCACCAAGACGATCTCGCTG
CTCTTCAATGCCATCCCTGCGTCCTTGGGAATGAAGCTTCGAGGGCTGTTGGATCGCAAG
GGCTCCTGGAAGAAGCTGGATGACATGCAGAACATCTTCTGGTGCCATAAGACCTTCACG
ACAAAGTATGTCACAGAGCACTGGTGTGAAGATCACTTCTTTGGGTACCAGTACCTGAAT
GGTGTCAATCCCGTCATGCTCCACTGCATCTCTAGCTTGCCCAGCAAGCTGCCTGTCACC
AATGACATGGTGGCCCCCTTGCTGGGACAGGACACATGCCTGCAGACAGAGCTAGAGAGG
GGGAACATCTTCCTAGCGGACTACTGGATCCTGGCGGAGGCCCCCACCCACTGCCTAAAC
GGCCGCCAGCAGTACGTGGCCGCCCCACTGTGCCTGCTGTGGCTCAGCCCCCAGGGGGCG
CTGGTGCCCTTGGCCATCCAGCTCAGCCAGACCCCCGGGCCTGACAGCCCCATCTTCCTG
CCCACTGACTCCGAATGGGACTGGCTGCTGGCCAAGACGTGGGTGCGCAACTCTGAGTTC
CTGGTGCACGAAAACAACACGCACTTTCTGTGCACGCATTTGCTGTGCGAGGCCTTCGCC
ATGGCCACGCTGCGCCAGCTGCCGCTCTGCCACCCCATCTACAAGCTCCTACTCCCCCAC
ACTCGATACACGCTGCAGGTGAACACCATCGCGAGGGCCACGCTGCTCAACCCCGAGGGC
CTCGTGGACCAGGTCACGTCCATCGGGAGGCAAGGCCTCATCTACCTCATGAGCACGGGC
CTGGCCCACTTCACCTACACCAATTTCTGCCTTCCGGACAGCCTGCGGGCCCGCGGCGTC
CTGGCTATCCCCAACTACCACTACCGAGACGACGGCCTGAAGATCTGGGCGGCCATTGAG
AGCTTTGTCTCAGAAATCGTGGGCTACTATTATCCCAGTGACGCATCTGTGCAGCAGGAT
TCGGAGCTGCAGGCCTGGACTGGCGAGATTTTTGCTCAGGCGTTCCTGGGCCGGGAAAGC
TCAGGTTTCCCAAGCCGGCTGTGCACCCCAGGAGAGATGGTGAAGTTCCTCACTGCAATC
ATCTTCAATTGCTCTGCCCAGCACGCTGCTGTCAACAGTGGGCAGCATGACTTTGGGGCC
TGGATGCCCAATGCTCCATCATCCATGAGGCAGCCCCCACCCCAGACCAAGGGGACCACC
ACCCTGAAGACTTACCTAGACACCCTCCCTGAAGTGAACATCAGCTGTAACAACCTCCTC
CTCTTCTGGTTGGTTAGCCAAGAACCCAAGGACCAGAGGCCCCTGGGCACCTACCCAGAT
GAGCACTTCACAGAGGAGGCCCCGAGGCGGAGCATCGCCGCCTTCCAGAGCCGCCTGGCC
CAGATCTCAAGGGACATCCAGGAGCGGAACCAGGGTCTGGCACTGCCCTACACCTACCTG
GACCCTCCCCTCATTGAGAACAGCGTCTCCATCTAA
Protein Properties
Number of Residues 711
Molecular Weight 80542.6
Theoretical pI 6.96
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Epidermis-type lipoxygenase 3
MAVYRLCVTTGPYLRAGTLDNISVTLVGTCGESPKQRLDRMGRDFAPGSVQKYKVRCTAE
LGELLLLRVHKERYAFFRKDSWYCSRICVTEPDGSVSHFPCYQWIEGYCTVELRPGTART
ICQDSLPLLLDHRTRELRARQECYRWKIYAPGFPCMVDVNSFQEMESDKKFALTKTTTCV
DQGDSSGNRYLPGFPMKIDIPSLMYMEPNVRYSATKTISLLFNAIPASLGMKLRGLLDRK
GSWKKLDDMQNIFWCHKTFTTKYVTEHWCEDHFFGYQYLNGVNPVMLHCISSLPSKLPVT
NDMVAPLLGQDTCLQTELERGNIFLADYWILAEAPTHCLNGRQQYVAAPLCLLWLSPQGA
LVPLAIQLSQTPGPDSPIFLPTDSEWDWLLAKTWVRNSEFLVHENNTHFLCTHLLCEAFA
MATLRQLPLCHPIYKLLLPHTRYTLQVNTIARATLLNPEGLVDQVTSIGRQGLIYLMSTG
LAHFTYTNFCLPDSLRARGVLAIPNYHYRDDGLKIWAAIESFVSEIVGYYYPSDASVQQD
SELQAWTGEIFAQAFLGRESSGFPSRLCTPGEMVKFLTAIIFNCSAQHAAVNSGQHDFGA
WMPNAPSSMRQPPPQTKGTTTLKTYLDTLPEVNISCNNLLLFWLVSQEPKDQRPLGTYPD
EHFTEEAPRRSIAAFQSRLAQISRDIQERNQGLALPYTYLDPPLIENSVSI
GenBank ID Protein 10441004
UniProtKB/Swiss-Prot ID Q9BYJ1
UniProtKB/Swiss-Prot Entry Name LOXE3_HUMAN
PDB IDs Not Available
GenBank Gene ID AF182218
GeneCard ID ALOXE3
GenAtlas ID ALOXE3
HGNC ID HGNC:13743
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Krieg P, Marks F, Furstenberger G: A gene cluster encoding human epidermis-type lipoxygenases at chromosome 17p13.1: cloning, physical mapping, and expression. Genomics. 2001 May 1;73(3):323-30. [PubMed:11350124 ]
  4. Jobard F, Lefevre C, Karaduman A, Blanchet-Bardon C, Emre S, Weissenbach J, Ozguc M, Lathrop M, Prud'homme JF, Fischer J: Lipoxygenase-3 (ALOXE3) and 12(R)-lipoxygenase (ALOX12B) are mutated in non-bullous congenital ichthyosiform erythroderma (NCIE) linked to chromosome 17p13.1. Hum Mol Genet. 2002 Jan 1;11(1):107-13. [PubMed:11773004 ]