You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08680
Secondary Accession Numbers
  • 14400
Name Natural resistance-associated macrophage protein 1
Synonyms
  1. NRAMP 1
Gene Name SLC11A1
Protein Type Unknown
Biological Properties
General Function Involved in transporter activity
Specific Function Divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Macrophage-specific membrane transport function. Controls natural resistance to infection with intracellular parasites. Pathogen resistance involves sequestration of Fe(2+) and Mn(2+), cofactors of both prokaryotic and eukaryotic catalases and superoxide dismutases, not only to protect the macrophage against its own generation of reactive oxygen species, but to deny the cations to the pathogen for synthesis of its protective enzymes
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transporter activity
Process
establishment of localization
transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Probable)
Gene Properties
Chromosome Location Chromosome:2
Locus 2q35
SNPs SLC11A1
Gene Sequence
>1653 bp
ATGACAGGTGACAAGGGTCCCCAAAGGCTAAGCGGGTCCAGCTATGGTTCCATCTCCAGC
CCGACCAGCCCGACCAGCCCAGGGCCACAGCAAGCACCTCCCAGAGAGACCTACCTGAGT
GAGAAGATCCCCATCCCAGACACAAAACCGGGCACCTTCAGCCTGCGGAAGCTATGGGCC
TTCACGGGGCCTGGCTTCCTCATGAGCATTGCTTTCCTGGACCCAGGAAACATCGAGTCA
GATCTTCAGGCTGGCGCCGTGGCGGGATTCAAACTTCTCTGGGTGCTGCTCTGGGCCACC
GTGTTGGGCTTGCTCTGCCAGCGACTGGCTGCACGTCTGGGCGTGGTGACAGGCAAGGAC
TTGGGCGAGGTCTGCCATCTCTACTACCCTAAGGTGCCCCGCACCGTCCTCTGGCTGACC
ATCGAGCTAGCCATTGTGGGCTCCGACATGCAGGAAGTCATCGGCACGGCCATTGCATTC
AATCTGCTCTCAGCTGGACGAATCCCACTCTGGGGTGGCGTCCTCATCACCATCGTGGAC
ACCTTCTTCTTCCTCTTCCTCGATAACTACGGGCTGCGGAAGCTGGAAGCTTTTTTTGGA
CTCCTTATAACCATTATGGCCTTGACCTTTGGCTATGAGTATGTGGTGGCGCGTCCTGAG
CAGGGAGCGCTTCTTCGGGGCCTGTTCCTGCCCTCGTGCCCGGGCTGCGGCCACCCCGAG
CTGCTGCAGGCGGTGGGCATTGTTGGCGCCATCATCATGCCCCACAACATCTACCTGCAC
TCGGCCCTGGTCAAGTCTCGAGAGATAGACCGGGCCCGCCGAGCGGACATCAGAGAAGCC
AACATGTACTTCCTGATTGAGGCCACCATCGCCCTGTCCGTCTCCTTTATCATCAACCTC
TTTGTCATGGCTGTCTTTGGGCAGGCCTTCTACCAGAAAACCAACCAGGCTGCGTTCAAC
ATCTGTGCCAACAGCAGCCTCCACGACTACGCCAAGATCTTCCCCATGAACAACGCCACC
GTGGCCGTGGACATTTACCAGGGGGGCGTGATCCTGGGCTGCCTGTTCGGCCCCGCGGCC
CTCTACATCTGGGCCATAGGTCTCCTGGCGGCTGGGCAGAGCTCCACCATGACGGGCACC
TACGCGGGACAGTTCGTGATGGAGGGCTTCCTGAGGCTGCGGTGGTCACGCTTCGCCCGT
GTCCTCCTCACCCGCTCCTGCGCCATCCTGCCCACCGTGCTCGTGGCTGTCTTCCGGGAC
CTGAGGGACTTGTCGGGCCTCAATGATCTGCTCAACGTGCTGCAGAGCCTGCTGCTCCCG
TTCGCCGTGCTGCCCATCCTCACGTTCACCAGCATGCCCACCCTCATGCAGGAGTTTGCC
AATGGCCTGCTGAACAAGGTCGTCACCTCTTCCATCATGGTGCTAGTCTGCGCCATCAAC
CTCTACTTCGTGGTCAGCTATCTGCCCAGCCTGCCCCACCCTGCCTACTTCGGCCTTGCA
GCCTTGCTGGCCGCAGCCTACCTGGGCCTCAGCACCTACCTGGTCTGGACCTGTTGCCTT
GCCCACGGAGCCACCTTTCTGGCCCACAGCTCCCACCACCACTTCCTGTATGGGCTCCTT
GAAGAGGACCAGAAAGGGGAGACCTCTGGCTAG
Protein Properties
Number of Residues 550
Molecular Weight 59871.6
Theoretical pI 7.72
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 59-76
  • 86-105
  • 143-163
  • 168-187
  • 197-217
  • 241-259
  • 288-307
  • 350-369
  • 401-418
  • 430-450
  • 467-488
  • 497-516
Protein Sequence
>Natural resistance-associated macrophage protein 1
MTGDKGPQRLSGSSYGSISSPTSPTSPGPQQAPPRETYLSEKIPIPDTKPGTFSLRKLWA
FTGPGFLMSIAFLDPGNIESDLQAGAVAGFKLLWVLLWATVLGLLCQRLAARLGVVTGKD
LGEVCHLYYPKVPRTVLWLTIELAIVGSDMQEVIGTAIAFNLLSAGRIPLWGGVLITIVD
TFFFLFLDNYGLRKLEAFFGLLITIMALTFGYEYVVARPEQGALLRGLFLPSCPGCGHPE
LLQAVGIVGAIIMPHNIYLHSALVKSREIDRARRADIREANMYFLIEATIALSVSFIINL
FVMAVFGQAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGVILGCLFGPAA
LYIWAIGLLAAGQSSTMTGTYAGQFVMEGFLRLRWSRFARVLLTRSCAILPTVLVAVFRD
LRDLSGLNDLLNVLQSLLLPFAVLPILTFTSMPTLMQEFANGLLNKVVTSSIMVLVCAIN
LYFVVSYLPSLPHPAYFGLAALLAAAYLGLSTYLVWTCCLAHGATFLAHSSHHHFLYGLL
EEDQKGETSG
GenBank ID Protein 10257411
UniProtKB/Swiss-Prot ID P49279
UniProtKB/Swiss-Prot Entry Name NRAM1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF229163
GeneCard ID SLC11A1
GenAtlas ID SLC11A1
HGNC ID HGNC:10907
References
General References
  1. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  2. Cellier M, Govoni G, Vidal S, Kwan T, Groulx N, Liu J, Sanchez F, Skamene E, Schurr E, Gros P: Human natural resistance-associated macrophage protein: cDNA cloning, chromosomal mapping, genomic organization, and tissue-specific expression. J Exp Med. 1994 Nov 1;180(5):1741-52. [PubMed:7964458 ]
  3. Kishi F, Nobumoto M: Identification of natural resistance-associated macrophage protein in peripheral blood lymphocytes. Immunol Lett. 1995 Jul-Aug;47(1-2):93-6. [PubMed:8537108 ]
  4. Marquet S, Lepage P, Hudson TJ, Musser JM, Schurr E: Complete nucleotide sequence and genomic structure of the human NRAMP1 gene region on chromosome region 2q35. Mamm Genome. 2000 Sep;11(9):755-62. [PubMed:10967134 ]
  5. Kishi F: Isolation and characterization of human Nramp cDNA. Biochem Biophys Res Commun. 1994 Nov 15;204(3):1074-80. [PubMed:7980580 ]
  6. Blackwell JM, Barton CH, White JK, Searle S, Baker AM, Williams H, Shaw MA: Genomic organization and sequence of the human NRAMP gene: identification and mapping of a promoter region polymorphism. Mol Med. 1995 Jan;1(2):194-205. [PubMed:8529098 ]
  7. Liu J, Fujiwara TM, Buu NT, Sanchez FO, Cellier M, Paradis AJ, Frappier D, Skamene E, Gros P, Morgan K, et al.: Identification of polymorphisms and sequence variants in the human homologue of the mouse natural resistance-associated macrophage protein gene. Am J Hum Genet. 1995 Apr;56(4):845-53. [PubMed:7717395 ]
  8. Malik S, Abel L, Tooker H, Poon A, Simkin L, Girard M, Adams GJ, Starke JR, Smith KC, Graviss EA, Musser JM, Schurr E: Alleles of the NRAMP1 gene are risk factors for pediatric tuberculosis disease. Proc Natl Acad Sci U S A. 2005 Aug 23;102(34):12183-8. Epub 2005 Aug 15. [PubMed:16103355 ]
  9. Stienstra Y, van der Werf TS, Oosterom E, Nolte IM, van der Graaf WT, Etuaful S, Raghunathan PL, Whitney EA, Ampadu EO, Asamoa K, Klutse EY, te Meerman GJ, Tappero JW, Ashford DA, van der Steege G: Susceptibility to Buruli ulcer is associated with the SLC11A1 (NRAMP1) D543N polymorphism. Genes Immun. 2006 Apr;7(3):185-9. [PubMed:16395392 ]