You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08687
Secondary Accession Numbers
  • 14408
Name Serine/threonine-protein phosphatase 5
Synonyms
  1. PP-T
  2. PP5
  3. PPT
  4. Protein phosphatase T
Gene Name PPP5C
Protein Type Unknown
Biological Properties
General Function Involved in hydrolase activity
Specific Function May play a role in the regulation of RNA biogenesis and/or mitosis. In vitro, dephosphorylates serine residues of skeletal muscle phosphorylase and histone H1.
Pathways
  • MAPK signaling pathway
Reactions
A phosphoprotein + Water → a protein + Phosphate details
GO Classification
Biological Process
positive regulation of I-kappaB kinase/NF-kappaB cascade
transcription, DNA-dependent
response to morphine
mitosis
protein dephosphorylation
Cellular Component
cytosol
Golgi apparatus
nucleus
neuronal cell body
neuron projection
Component
cell part
intracellular part
cytoplasm
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
Function
phosphoprotein phosphatase activity
ion binding
cation binding
metal ion binding
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
protein serine/threonine phosphatase activity
Molecular Function
protein serine/threonine phosphatase activity
metal ion binding
signal transducer activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location 19
Locus 19q13.3
SNPs PPP5C
Gene Sequence
>1500 bp
ATGGCGATGGCGGAGGGCGAGAGGACTGAGTGTGCTGAGCCCCCCCGGGACGAACCCCCG
GCTGATGGAGCTCTGAAGCGGGCAGAGGAGCTCAAGACTCAGGCCAATGACTACTTCAAA
GCCAAGGACTACGAGAACGCCATCAAGTTCTACAGCCAGGCCATCGAGCTGAACCCCAGC
AATGCCATCTACTATGGCAACCGCAGCCTGGCCTACCTGCGCACTGAGTGCTATGGCTAC
GCGCTGGGAGACGCCACGCGGGCCATTGAGCTGGACAAGAAGTACATCAAGGGTTATTAC
CGCCGGGCTGCCAGCAACATGGCACTGGGCAAGTTCCGGGCCGCGCTGCGAGACTACGAG
ACGGTGGTCAAGGTGAAGCCCCATGACAAGGATGCCAAAATGAAATACCAGGAGTGCAAC
AAGATCGTGAAGCAGAAGGCCTTTGAGCGGGCCATCGCGGGCGACGAGCACAAGCGCTCC
GTGGTGGACTCGCTGGACATCGAGAGCATGACCATTGAGGATGAGTACAGCGGACCCAAG
CTTGAAGACGGCAAAGTGACAATCAGTTTCATGAAGGAGCTCATGCAGTGGTACAAGGAC
CAGAAGAAACTGCACCGGAAATGTGCCTACCAGATTCTGGTACAGGTCAAAGAGGTCCTC
TCCAAGCTGAGCACGCTCGTGGAAACCACACTCAAAGAGACAGAGAAGATTACAGTATGT
GGGGACACCCATGGCCAGTTCTATGACCTCCTCAACATATTCGAGCTCAACGGTTTACCC
TCGGAGACCAACCCCTATATATTTAATGGTGACTTTGTGGACCGAGGCTCCTTCTCTGTA
GAAGTGATCCTCACCCTTTTCGGCTTCAAGCTCCTGTACCCAGATCACTTTCACCTCCTT
CGAGGCAACCACGAGACAGACAACATGAACCAGATCTACGGTTTCGAGGGTGAGGTGAAG
GCCAAGTACACAGCCCAGATGTACGAGCTCTTTAGCGAGGTGTTCGAGTGGCTCCCGTTG
GCCCAGTGCATCAACGGCAAAGTGCTGATCATGCACGGAGGCCTGTTCAGTGAAGACGGT
GTCACCCTGGATGACATCCGGAAAATTGAGCGGAATCGACAACCCCCAGATTCAGGGCCC
ATGTGTGACCTGCTCTGGTCAGATCCACAGCCACAGAACGGGCGCTCGATCAGCAAGCGG
GGCGTGAGCTGTCAGTTTGGGCCTGACGTCACCAAGGCCTTCTTGGAAGAGAACAACCTG
GACTATATCATCCGCAGCCACGAAGTCAAGGCCGAGGGCTACGAGGTGGCTCACGGAGGC
CGCTGTGTCACCGTCTTCTCTGCCCCCAACTACTGCGACCAGATGGGGAACAAAGCCTCC
TACATCCACCTCCAGGGCTCTGACCTACGGCCTCAGTTCCACCAGTTCACAGCAGTGCCT
CATCCCAACGTCAAGCCCATGGCCTATGCCAACACGCTGCTGCAGCTAGGAATGATGTAG
Protein Properties
Number of Residues 499
Molecular Weight 56878.22
Theoretical pI 6.274
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Serine/threonine-protein phosphatase 5
MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPS
NAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYE
TVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPK
LEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVC
GDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLL
RGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDG
VTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNL
DYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVP
HPNVKPMAYANTLLQLGMM
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P53041
UniProtKB/Swiss-Prot Entry Name PPP5_HUMAN
PDB IDs
GenBank Gene ID BT007275
GeneCard ID PPP5C
GenAtlas ID PPP5C
HGNC ID HGNC:9322
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  3. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  4. Chen MX, McPartlin AE, Brown L, Chen YH, Barker HM, Cohen PT: A novel human protein serine/threonine phosphatase, which possesses four tetratricopeptide repeat motifs and localizes to the nucleus. EMBO J. 1994 Sep 15;13(18):4278-90. [PubMed:7925273 ]
  5. Yong WH, Ueki K, Chou D, Reeves SA, von Deimling A, Gusella JF, Mohrenweiser HW, Buckler AJ, Louis DN: Cloning of a highly conserved human protein serine-threonine phosphatase gene from the glioma candidate region on chromosome 19q13.3. Genomics. 1995 Sep 20;29(2):533-6. [PubMed:8666404 ]
  6. Xu X, Lagercrantz J, Zickert P, Bajalica-Lagercrantz S, Zetterberg A: Chromosomal localization and 5' sequence of the human protein serine/threonine phosphatase 5' gene. Biochem Biophys Res Commun. 1996 Jan 17;218(2):514-7. [PubMed:8561788 ]
  7. Ollendorff V, Donoghue DJ: The serine/threonine phosphatase PP5 interacts with CDC16 and CDC27, two tetratricopeptide repeat-containing subunits of the anaphase-promoting complex. J Biol Chem. 1997 Dec 19;272(51):32011-8. [PubMed:9405394 ]
  8. Das AK, Cohen PW, Barford D: The structure of the tetratricopeptide repeats of protein phosphatase 5: implications for TPR-mediated protein-protein interactions. EMBO J. 1998 Mar 2;17(5):1192-9. [PubMed:9482716 ]