You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08688
Secondary Accession Numbers
  • 14409
Name Serine/threonine-protein phosphatase 6 catalytic subunit
Synonyms
  1. PP6C
Gene Name PPP6C
Protein Type Unknown
Biological Properties
General Function Involved in hydrolase activity
Specific Function Catalytic subunit of protein phosphatase 6 (PP6). PP6 is a component of a signaling pathway regulating cell cycle progression in response to IL2 receptor stimulation. N-terminal domain restricts G1 to S phase progression in cancer cells, in part through control of cyclin D1. Downregulates MAP3K7 kinase activation of the IL1 signaling pathway by dephosphorylation of MAP3K7.
Pathways Not Available
Reactions
A phosphoprotein + Water → a protein + Phosphate details
GO Classification
Biological Process
G1/S transition of mitotic cell cycle
protein dephosphorylation
Cellular Component
cytosol
Function
catalytic activity
hydrolase activity
Molecular Function
protein serine/threonine phosphatase activity
metal ion binding
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 9
Locus 9q33.3
SNPs PPP6C
Gene Sequence
>918 bp
ATGGCGCCGCTAGACCTGGACAAGTATGTGGAAATAGCGCGGCTGTGCAAGTACCTGCCA
GAGAACGACCTGAAGCGGCTATGTGACTACGTTTGTGACCTCCTCTTAGAAGAGTCAAAT
GTTCAGCCAGTATCAACACCAGTAACAGTGTGTGGAGATATCCATGGACAGTTTTATGAC
CTTTGTGAACTGTTCAGAACTGGAGGTCAGGTTCCTGACACAAACTACATATTTATGGGT
GATTTTGTAGACAGAGGTTACTATAGTTTGGAGACCTTCACTTACCTTCTTGCATTAAAG
GCTAAATGGCCTGATCGTATTACACTTTTGCGAGGAAATCATGAGAGTAGACAGATAACA
CAGGTCTATGGATTTTATGATGAGTGCCAAACCAAATATGGAAATGCTAATGCCTGGAGA
TACTGTACCAAAGTTTTTGACATGCTCACAGTAGCAGCTTTAATAGATGAGCAGATTTTG
TGTGTCCATGGTGGTTTATCTCCTGATATCAAAACACTGGATCAAATTCGAACCATCGAA
CGGAATCAGGAAATTCCTCATAAAGGAGCATTTTGTGATCTGGTTTGGTCAGATCCTGAA
GATGTGGATACCTGGGCTATCAGTCCCCGAGGAGCAGGTTGGCTTTTTGGAGCAAAGGTC
ACAAATGAGTTTGTTCATATCAACAACTTAAAACTCATCTGCAGAGCACATCAACTAGTG
CACGAAGGCTATAAATTTATGTTTGATGAGAAGCTGGTGACAGTATGGTCTGCTCCTAAT
TACTGCTATCGTTGTGGAAATATTGCTTCGATCATGGTCTTCAAAGATGTAAATACAAGA
GAACCAAAGTTATTCCGGGCAGTTCCAGATTCAGAACGTGTTATTCCTCCCAGAACGACA
ACGCCATATTTCCTTTGA
Protein Properties
Number of Residues 305
Molecular Weight 38946.415
Theoretical pI 6.179
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Serine/threonine-protein phosphatase 6 catalytic subunit
MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYD
LCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQIT
QVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIE
RNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLV
HEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTT
TPYFL
GenBank ID Protein 4506029
UniProtKB/Swiss-Prot ID O00743
UniProtKB/Swiss-Prot Entry Name PPP6_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_002721.4
GeneCard ID PPP6C
GenAtlas ID PPP6C
HGNC ID HGNC:9323
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  4. Kajino T, Ren H, Iemura S, Natsume T, Stefansson B, Brautigan DL, Matsumoto K, Ninomiya-Tsuji J: Protein phosphatase 6 down-regulates TAK1 kinase activation in the IL-1 signaling pathway. J Biol Chem. 2006 Dec 29;281(52):39891-6. Epub 2006 Nov 1. [PubMed:17079228 ]
  5. Bastians H, Ponstingl H: The novel human protein serine/threonine phosphatase 6 is a functional homologue of budding yeast Sit4p and fission yeast ppe1, which are involved in cell cycle regulation. J Cell Sci. 1996 Dec;109 ( Pt 12):2865-74. [PubMed:9013334 ]
  6. Filali M, Li S, Kim HW, Wadzinski B, Kamoun M: Identification of a type 6 protein ser/thr phosphatase regulated by interleukin-2 stimulation. J Cell Biochem. 1999 May 1;73(2):153-63. [PubMed:10227379 ]
  7. Chen J, Peterson RT, Schreiber SL: Alpha 4 associates with protein phosphatases 2A, 4, and 6. Biochem Biophys Res Commun. 1998 Jun 29;247(3):827-32. [PubMed:9647778 ]
  8. Stefansson B, Brautigan DL: Protein phosphatase 6 subunit with conserved Sit4-associated protein domain targets IkappaBepsilon. J Biol Chem. 2006 Aug 11;281(32):22624-34. Epub 2006 Jun 12. [PubMed:16769727 ]
  9. Stefansson B, Brautigan DL: Protein phosphatase PP6 N terminal domain restricts G1 to S phase progression in human cancer cells. Cell Cycle. 2007 Jun 1;6(11):1386-92. Epub 2007 Jun 11. [PubMed:17568194 ]
  10. Stefansson B, Ohama T, Daugherty AE, Brautigan DL: Protein phosphatase 6 regulatory subunits composed of ankyrin repeat domains. Biochemistry. 2008 Feb 5;47(5):1442-51. doi: 10.1021/bi7022877. Epub 2008 Jan 11. [PubMed:18186651 ]